(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE210

ASFUM1_6.PE210       Location/Qualifiers
FT   CDS             complement(686544..688214)
FT                   /codon_start=1
FT                   /gene_family="HOG000201805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207665"
FT                   /orf_name="AFUA_6G03240"
FT                   /product="Putative uncharacterized protein "
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="EAL85715.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG056279"
FT                   /db_xref="HOGENOM:HBG333956"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000051E5C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD23"
FT                   /transl_table=1
FT                   /translation="MDIYGTAVTAITQVYQVTIFIKGVVSDIKAFDDDRAEIQLKLNLQ
FT                   LTTLLFFKRICFHPEHGLLLPGKLDPFIADTVEGLLVQMRKTLAEYELVAAKYGLIDDE
FT                   LAIEPDKPATTQESLLERAKSKARSLKLKGYDWSLFDKKRLNRILDAYTKWSEDLRNIM
FT                   LHMSQDTLAKMAESDHQGLRSSGLEPVMKRRTLAAAKAPADYQSLTGTLAEEGKTMGGF
FT                   RLGKWTASESEAMPVIVEYHEYESRLKRDDLEPDEIEELKEPIRNLAWLLQNTTFSGTS
FT                   ANSLDQPKIYALECLGFLDQPTDERTVFLYKLPPSEPTTPDTTLTTLHAFINAVDSQTK
FT                   RPLKKPSLNDRFSMAHSLALTVANLHASAWLHKNIWSRGILLFLETPAGTSAAGLYAHR
FT                   LAPSPKDNTRIVSYLSDWGYARSVQQGTEMRSDFEVEPNLYRHPDRQGRPSHQFSREHD
FT                   IYALGVVLLEIGLWVTMSRLMEARIREAETSGRLPRSKKVLEDLIALAQQGLPKEMGVG
FT                   YTKAVLACLKGEFRGREGPALAVDFQEKVVDVLAGGINM"
     MDIYGTAVTA ITQVYQVTIF IKGVVSDIKA FDDDRAEIQL KLNLQLTTLL FFKRICFHPE        60
     HGLLLPGKLD PFIADTVEGL LVQMRKTLAE YELVAAKYGL IDDELAIEPD KPATTQESLL       120
     ERAKSKARSL KLKGYDWSLF DKKRLNRILD AYTKWSEDLR NIMLHMSQDT LAKMAESDHQ       180
     GLRSSGLEPV MKRRTLAAAK APADYQSLTG TLAEEGKTMG GFRLGKWTAS ESEAMPVIVE       240
     YHEYESRLKR DDLEPDEIEE LKEPIRNLAW LLQNTTFSGT SANSLDQPKI YALECLGFLD       300
     QPTDERTVFL YKLPPSEPTT PDTTLTTLHA FINAVDSQTK RPLKKPSLND RFSMAHSLAL       360
     TVANLHASAW LHKNIWSRGI LLFLETPAGT SAAGLYAHRL APSPKDNTRI VSYLSDWGYA       420
     RSVQQGTEMR SDFEVEPNLY RHPDRQGRPS HQFSREHDIY ALGVVLLEIG LWVTMSRLME       480
     ARIREAETSG RLPRSKKVLE DLIALAQQGL PKEMGVGYTK AVLACLKGEF RGREGPALAV       540
     DFQEKVVDVL AGGINM                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page