(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE213

ASFUM1_6.PE213       Location/Qualifiers
FT   CDS             694435..695010
FT                   /codon_start=1
FT                   /gene_family="HOG000217800" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056380"
FT                   /orf_name="AFUA_6G03270"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85711.1"
FT                   /db_xref="HOGENOM:HBG056275"
FT                   /db_xref="UniParc:UPI000051FDB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD27"
FT                   /transl_table=1
FT                   /translation="MLTHIQHLPLELREKLALLPESPSREEIYVLWTHLLQRYFPFRLH
FT                   GSLPNLADLPDETAVKYALGNHQESESSHIALAVGREYGPFDRLSFLHVFCQAETKEKW
FT                   HLAEMQDKLKEEMMKSSHCEIARRRGMTIHGAIVVSRQVEFYKMKRDGSFECMTWLAQE
FT                   KKRLHILRDMRTITSHLMQINYEVRLRD"
     MLTHIQHLPL ELREKLALLP ESPSREEIYV LWTHLLQRYF PFRLHGSLPN LADLPDETAV        60
     KYALGNHQES ESSHIALAVG REYGPFDRLS FLHVFCQAET KEKWHLAEMQ DKLKEEMMKS       120
     SHCEIARRRG MTIHGAIVVS RQVEFYKMKR DGSFECMTWL AQEKKRLHIL RDMRTITSHL       180
     MQINYEVRLR D                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page