(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE216

ASFUM1_6.PE216       Location/Qualifiers
FT   CDS             702641..703534
FT                   /codon_start=1
FT                   /gene_family="HOG000178921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207667"
FT                   /orf_name="AFUA_6G03300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85708.1"
FT                   /db_xref="HOGENOM:HBG053570"
FT                   /db_xref="HOGENOM:HBG332305"
FT                   /db_xref="UniParc:UPI0000520932"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD30"
FT                   /transl_table=1
FT                   /translation="MTKIDVINSGFNLGNELDYMLDRSYTAASRLNYQFYLWKDTLRFN
FT                   LHPSIQLPKDESTPVRIADLATGTAIWLLDLLRDPAVARYKSIRLDGFDIDLANAPLPE
FT                   WLPTPITLRQLSLFETVPGDLRGNYDVVHLRLLVLVVQNSDPLPIINQAYQLLKPGGYI
FT                   QWDDLNYPDGAVVKANALRDVATPAHDAFLRFARSNGRNDWVLDLPRHLMSRHGGFEDA
FT                   HIRNYTDRVELRKANGDQYILVMEEFSARLKRAGKMEDAHNIDLMIRGLAEESRRGVGL
FT                   SMPKAVCVARKKGGRA"
     MTKIDVINSG FNLGNELDYM LDRSYTAASR LNYQFYLWKD TLRFNLHPSI QLPKDESTPV        60
     RIADLATGTA IWLLDLLRDP AVARYKSIRL DGFDIDLANA PLPEWLPTPI TLRQLSLFET       120
     VPGDLRGNYD VVHLRLLVLV VQNSDPLPII NQAYQLLKPG GYIQWDDLNY PDGAVVKANA       180
     LRDVATPAHD AFLRFARSNG RNDWVLDLPR HLMSRHGGFE DAHIRNYTDR VELRKANGDQ       240
     YILVMEEFSA RLKRAGKMED AHNIDLMIRG LAEESRRGVG LSMPKAVCVA RKKGGRA          297
//

If you have problems or comments...

PBIL Back to PBIL home page