(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE217

ASFUM1_6.PE217       Location/Qualifiers
FT   CDS             704042..704680
FT                   /codon_start=1
FT                   /gene_family="HOG000178943" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264293"
FT                   /orf_name="AFUA_6G03310"
FT                   /product="Putative uncharacterized protein "
FT                   /function="methyltransferase activity"
FT                   /protein_id="EAL85707.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG056272"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000051FDB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD31"
FT                   /transl_table=1
FT                   /translation="MFLLPGIAAFPQFQRVVELARQGGIVLDLGCGLGQNLRLLAACGV
FT                   PSNQMWALDLSPQLWRLGYELYRDRDRMLATFIPGNFLHEDDCLGLRELYGQVDIMIAG
FT                   QFLHLFSWEGQKQAGKRIVALSKRGTVLIGYQQSRRRAREYMRPWGMMFYHNRDSFLQM
FT                   WREISLETSTDWKVEATEVDLAEWGMEAEDTEWMPADRQGLNFVLTRVH"
     MFLLPGIAAF PQFQRVVELA RQGGIVLDLG CGLGQNLRLL AACGVPSNQM WALDLSPQLW        60
     RLGYELYRDR DRMLATFIPG NFLHEDDCLG LRELYGQVDI MIAGQFLHLF SWEGQKQAGK       120
     RIVALSKRGT VLIGYQQSRR RAREYMRPWG MMFYHNRDSF LQMWREISLE TSTDWKVEAT       180
     EVDLAEWGME AEDTEWMPAD RQGLNFVLTR VH                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page