(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE226

ASFUM1_6.PE226       Location/Qualifiers
FT   CDS             join(725580..725630,725725..725899,725969..726098,
FT                   726154..726199,726257..726586)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056382"
FT                   /orf_name="AFUA_6G03390"
FT                   /product="Glutathione S-transferase family protein,
FT                   putative"
FT                   /EC_number="2.5.1.18"
FT                   /function="glutathione transferase activity"
FT                   /protein_id="EAL85699.2"
FT                   /db_xref="GO:0004364"
FT                   /db_xref="HOGENOM:HBG056267"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0000F51CDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD39"
FT                   /transl_table=1
FT                   /translation="MASFYAAETPERVKKAQLTLTKGLHLITSLTPNGRKVHILLEELK
FT                   DTYGLEWMISLIDLDKNEQKKDWFLRLNPNGRIPILIDNNTCPPHVVMKSSAELLYLVN
FT                   LADKDNIFWFLDLIDKCNIIFLGIMRTKALTVASENCCRCTTYLKSVFQGDMVAAHGSI
FT                   WLGRVRANTALLISMPGPGCEIFDALDSRRMSWLRYLIYNSGWIALRRDQLWSEVWGSG
FT                   MMRMCIQSYCLRLRDYLLRCA"
     MASFYAAETP ERVKKAQLTL TKGLHLITSL TPNGRKVHIL LEELKDTYGL EWMISLIDLD        60
     KNEQKKDWFL RLNPNGRIPI LIDNNTCPPH VVMKSSAELL YLVNLADKDN IFWFLDLIDK       120
     CNIIFLGIMR TKALTVASEN CCRCTTYLKS VFQGDMVAAH GSIWLGRVRA NTALLISMPG       180
     PGCEIFDALD SRRMSWLRYL IYNSGWIALR RDQLWSEVWG SGMMRMCIQS YCLRLRDYLL       240
     RCA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page