(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE227

ASFUM1_6.PE227       Location/Qualifiers
FT   CDS             join(complement(729157..729251),complement(729078..729109),
FT                   complement(728865..729031))
FT                   /codon_start=1
FT                   /gene_family="HOG000201772" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264299"
FT                   /orf_name="AFUA_6G03400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85698.2"
FT                   /db_xref="HOGENOM:HBG056266"
FT                   /db_xref="HOGENOM:HBG325058"
FT                   /db_xref="UniParc:UPI0000F51CD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD40"
FT                   /transl_table=1
FT                   /translation="MSSFATPSPHSPRPFFKRPAYPSFKVGRVGKLYLPAMAVVAAGFG
FT                   IANYLNDFQAQQARYQLQEEERIRQNQKLMDAYGDKDSLHDVQHALEAYEIQ"
     MSSFATPSPH SPRPFFKRPA YPSFKVGRVG KLYLPAMAVV AAGFGIANYL NDFQAQQARY        60
     QLQEEERIRQ NQKLMDAYGD KDSLHDVQHA LEAYEIQ                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page