(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE240

ASFUM1_6.PE240       Location/Qualifiers
FT   CDS             771750..772142
FT                   /codon_start=1
FT                   /gene_family="HOG000217805" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207674"
FT                   /orf_name="AFUA_6G03550"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85684.1"
FT                   /db_xref="HOGENOM:HBG056257"
FT                   /db_xref="UniParc:UPI000051EF15"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD54"
FT                   /transl_table=1
FT                   /translation="MSQRPTSSHDSSAPHHIPVDDCLTYDTGYRPNLPGQRTWWVFCPV
FT                   TGAFDNSYALLGAMIECVARGQATLAPAWDRTFAGGIWYDFDCGADVLDGRLLMDMAVD
FT                   DMQRRIERYMSTNDGQMGCKPALGFR"
     MSQRPTSSHD SSAPHHIPVD DCLTYDTGYR PNLPGQRTWW VFCPVTGAFD NSYALLGAMI        60
     ECVARGQATL APAWDRTFAG GIWYDFDCGA DVLDGRLLMD MAVDDMQRRI ERYMSTNDGQ       120
     MGCKPALGFR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page