(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE241

ASFUM1_6.PE241       Location/Qualifiers
FT   CDS             join(complement(773547..773834),complement(773173..773496))
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264303"
FT                   /orf_name="AFUA_6G03560"
FT                   /product="IgE-binding protein, putative "
FT                   /protein_id="EAL85683.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051FB4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD55"
FT                   /transl_table=1
FT                   /translation="MKIPVLFSLLTLASAVSIPIRNNGHSNSYSYHTSNSTKFSVMSAR
FT                   SGSPIHLLPMNAAHGNFWLGESPSTFCPEPVEKVSGCPPGTTTRFASANALDVAVPGGQ
FT                   RIYVDPRGALRFTTAHSGSIPPGSSTGPFVHSAGTPFGHFAYKGQGAKGFIACPKSNGT
FT                   ATHWQVYASVANVASGAECLGFNALAVPSNDTRAAAWEYI"
     MKIPVLFSLL TLASAVSIPI RNNGHSNSYS YHTSNSTKFS VMSARSGSPI HLLPMNAAHG        60
     NFWLGESPST FCPEPVEKVS GCPPGTTTRF ASANALDVAV PGGQRIYVDP RGALRFTTAH       120
     SGSIPPGSST GPFVHSAGTP FGHFAYKGQG AKGFIACPKS NGTATHWQVY ASVANVASGA       180
     ECLGFNALAV PSNDTRAAAW EYI                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page