(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE245

ASFUM1_6.PE245       Location/Qualifiers
FT   CDS             join(complement(786433..786646),complement(786292..786359),
FT                   complement(785988..786237),complement(785658..785881),
FT                   complement(785080..785526))
FT                   /codon_start=1
FT                   /gene_family="HOG000217806" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903122"
FT                   /orf_name="AFUA_6G03600"
FT                   /product="Integral membrane protein (Pth11), putative "
FT                   /protein_id="EAL85679.1"
FT                   /db_xref="HOGENOM:HBG056254"
FT                   /db_xref="HOGENOM:HBG327871"
FT                   /db_xref="UniParc:UPI000051F8C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD59"
FT                   /transl_table=1
FT                   /translation="MGWVYNLETPDPHSQVPRVIAICLVFPIVAFLAVLLRLYVRIHTK
FT                   RAAGVDDYAALFSSILAIAYGAISIAQSRWGLGLDAKYFPKENVVPFSRVQYAGGPVYT
FT                   LALLGFKVSLLASYLRIGGFVKAYRTVIIAVIVACVCNQLAFTFVLCFACRPIARQWDM
FT                   SIQGSCIDTVASYYGTSLAFDCIIIALPLPVLITLRLQRRQKAALLAVFALGFFVTIIQ
FT                   IIRIFTIKNLKTYTDSQPIVLWSVIEISLGVIISCIPTYGPLFHSLSLISSTRRRHADG
FT                   YRSQSYRLNSQSNHPTGYIHGSGSRPFDSSIPATTTIMSTAVEREQERERDKVSSDGDS
FT                   EERILAPCAQTNPKGHSQSRAQRSGSETTLEELKGMRETGIHTVTEVTVESHSVKECGW
FT                   N"
     MGWVYNLETP DPHSQVPRVI AICLVFPIVA FLAVLLRLYV RIHTKRAAGV DDYAALFSSI        60
     LAIAYGAISI AQSRWGLGLD AKYFPKENVV PFSRVQYAGG PVYTLALLGF KVSLLASYLR       120
     IGGFVKAYRT VIIAVIVACV CNQLAFTFVL CFACRPIARQ WDMSIQGSCI DTVASYYGTS       180
     LAFDCIIIAL PLPVLITLRL QRRQKAALLA VFALGFFVTI IQIIRIFTIK NLKTYTDSQP       240
     IVLWSVIEIS LGVIISCIPT YGPLFHSLSL ISSTRRRHAD GYRSQSYRLN SQSNHPTGYI       300
     HGSGSRPFDS SIPATTTIMS TAVEREQERE RDKVSSDGDS EERILAPCAQ TNPKGHSQSR       360
     AQRSGSETTL EELKGMRETG IHTVTEVTVE SHSVKECGWN                             400
//

If you have problems or comments...

PBIL Back to PBIL home page