(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE247

ASFUM1_6.PE247       Location/Qualifiers
FT   CDS             join(complement(794196..794205),complement(794017..794145),
FT                   complement(792628..793969),complement(792141..792558))
FT                   /codon_start=1
FT                   /gene_family="HOG000044189" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264307"
FT                   /orf_name="AFUA_6G03630"
FT                   /product="Very-long-chain acyl-CoA synthetase family
FT                   protein (CefD1), putative"
FT                   /EC_number="6.2.1.-"
FT                   /function="ligase activity"
FT                   /protein_id="EAL85676.2"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058423"
FT                   /db_xref="HOGENOM:HBG712034"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI0000F51CE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD62"
FT                   /transl_table=1
FT                   /translation="MSLGVAAAAVAGGATLAAYLNAKFHITKDISTLYVAWKSNRSFEQ
FT                   AAAKGLGNVWFVFLETAAKYPDMVCMWTREGIYTYRDVQNLACQYAHYFLAQGVKQGDL
FT                   VAFYLQNRAEFMIAWLALCSIGCAPAAINYNLTGDALVHCLKISGAKLVLVDDDEACRA
FT                   RIDDSRAAIEGPLGMELIYLDHSFASQVSSFPTTKPPKEFAQSMSGADPAILLYTSGTT
FT                   GMPKGCAFTMARLYSTLALRRGSMEDTDGPGGDIWYSCMPLYHGTAAVAMMVCLTTGVS
FT                   IALGKKFSVRNFWRDIRDSHATVFVYVGEVARYLLAAPPSPDDRNHSVRCMYGNGLRPD
FT                   IWEKFQQRFGISAVAEFFNSTEGLFGLFNLNKGPFTAGSVGHHGLLMRAIMHNTFVPVA
FT                   IDPTTGDVLRDPKTGFAMRAPYDQGGEILVNVPNEQAFQGYWRNESATSKKFLRDVFTK
FT                   GDLWYRSGDALRRQSDGRWYFLDRLGDTFRWKSENVATAEVAEILGRYPGIQEANVYGV
FT                   LVPHHEGRAGCAALHLSPEAREAFDFRGLAAFARARLPRYAVPVFLRIVETSAHIHNHK
FT                   QNKVPLREEGIDPAKIGSKVPEGRDDKFYWLPPGADGYVEFGKREWETMLAGSARL"
     MSLGVAAAAV AGGATLAAYL NAKFHITKDI STLYVAWKSN RSFEQAAAKG LGNVWFVFLE        60
     TAAKYPDMVC MWTREGIYTY RDVQNLACQY AHYFLAQGVK QGDLVAFYLQ NRAEFMIAWL       120
     ALCSIGCAPA AINYNLTGDA LVHCLKISGA KLVLVDDDEA CRARIDDSRA AIEGPLGMEL       180
     IYLDHSFASQ VSSFPTTKPP KEFAQSMSGA DPAILLYTSG TTGMPKGCAF TMARLYSTLA       240
     LRRGSMEDTD GPGGDIWYSC MPLYHGTAAV AMMVCLTTGV SIALGKKFSV RNFWRDIRDS       300
     HATVFVYVGE VARYLLAAPP SPDDRNHSVR CMYGNGLRPD IWEKFQQRFG ISAVAEFFNS       360
     TEGLFGLFNL NKGPFTAGSV GHHGLLMRAI MHNTFVPVAI DPTTGDVLRD PKTGFAMRAP       420
     YDQGGEILVN VPNEQAFQGY WRNESATSKK FLRDVFTKGD LWYRSGDALR RQSDGRWYFL       480
     DRLGDTFRWK SENVATAEVA EILGRYPGIQ EANVYGVLVP HHEGRAGCAA LHLSPEAREA       540
     FDFRGLAAFA RARLPRYAVP VFLRIVETSA HIHNHKQNKV PLREEGIDPA KIGSKVPEGR       600
     DDKFYWLPPG ADGYVEFGKR EWETMLAGSA RL                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page