(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE259

ASFUM1_6.PE259       Location/Qualifiers
FT   CDS             830413..831825
FT                   /codon_start=1
FT                   /gene_family="HOG000201727" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903125"
FT                   /orf_name="AFUA_6G03760"
FT                   /product="HhH-GPD family base excision DNA repair protein "
FT                   /EC_number="4.2.99.18"
FT                   /function="DNA binding"
FT                   /function="DNA-(apurinic or apyrimidinic site) lyase
FT                   activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="EAL85663.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003906"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG056247"
FT                   /db_xref="HOGENOM:HBG327866"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000051FB4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD75"
FT                   /transl_table=1
FT                   /translation="MTRRVTRSAAAREAALFAAKAQDVKPQLTDSNGPDVSPKTGKSTP
FT                   GRKRKLPIEHPEKLSKSSKTSKPKGSLPSLNVNDDLPHNLGSVSQPHESINVEPKLNKQ
FT                   DPGIEEEEDLDNLASDLQKTVDKATEGLPQQIKISKKKNPYGLTPGATPFPEWARPTPE
FT                   ECEEVNRLLSSAHGEVIPPSKIPEPSLTVTGCGEVPSVLDALIRTLLSGATTGRNSALA
FT                   FGGLVQRFGILEEGIGKGSVNWDAVRQAPLKDVFEAIKRGGLAEIKSRKIKAILDMVYQ
FT                   ENQERKEFLVKGESDGSSDLMPGEKEYEIACADQNFLSLNHLHTLSTEDAMTELVKYPG
FT                   IGPKTAACVILFCLQRPCFAVDTHIFRICKWLGWVPPGKATEVTAFSHLEVRIPDYLKY
FT                   SLHQLLIRHGKTCPRCRAITGQSSAGWEDGCVIDHLVTRTGKKKEGNTNVPVASKRRTG
FT                   RKIRAETDGSDE"
     MTRRVTRSAA AREAALFAAK AQDVKPQLTD SNGPDVSPKT GKSTPGRKRK LPIEHPEKLS        60
     KSSKTSKPKG SLPSLNVNDD LPHNLGSVSQ PHESINVEPK LNKQDPGIEE EEDLDNLASD       120
     LQKTVDKATE GLPQQIKISK KKNPYGLTPG ATPFPEWARP TPEECEEVNR LLSSAHGEVI       180
     PPSKIPEPSL TVTGCGEVPS VLDALIRTLL SGATTGRNSA LAFGGLVQRF GILEEGIGKG       240
     SVNWDAVRQA PLKDVFEAIK RGGLAEIKSR KIKAILDMVY QENQERKEFL VKGESDGSSD       300
     LMPGEKEYEI ACADQNFLSL NHLHTLSTED AMTELVKYPG IGPKTAACVI LFCLQRPCFA       360
     VDTHIFRICK WLGWVPPGKA TEVTAFSHLE VRIPDYLKYS LHQLLIRHGK TCPRCRAITG       420
     QSSAGWEDGC VIDHLVTRTG KKKEGNTNVP VASKRRTGRK IRAETDGSDE                  470
//

If you have problems or comments...

PBIL Back to PBIL home page