(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE261

ASFUM1_6.PE261       Location/Qualifiers
FT   CDS             complement(834400..835821)
FT                   /codon_start=1
FT                   /gene_family="HOG000201716" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264312"
FT                   /orf_name="AFUA_6G03780"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85661.1"
FT                   /db_xref="HOGENOM:HBG056245"
FT                   /db_xref="HOGENOM:HBG331376"
FT                   /db_xref="UniParc:UPI000051EF01"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD77"
FT                   /transl_table=1
FT                   /translation="MLTPIRVRGRRKKALAQNSNHAQGGKARPSGPKGGRPLMSREARL
FT                   DSSQARNNKRARLWAARPSKRRKTLSLLETLPVELIEKIFLYSLNVNLPRASPSLAAAV
FT                   SSERIYRMLILLGFWNDSASEAEDPDSAISRILRPLDYAPLQDDDRENLQTSVLRCRWC
FT                   TMPRLLMQLSDMTNLTIQRHWVNAGIEMTRDQQESLDRFLARENDTSTYEGTDKDGNHY
FT                   TLSITPFVSINIACQETDEQQTHKILSIKHFPEKLLLGASGEGFSDDHATHLEIMRVAC
FT                   GLSRSDHLETDVSVSRESLHQGVHIALVEHNTRALATLLKIDEYIFRSNAAVAGGLPYS
FT                   IPPEHFRTAVRVARNDPALFQTLLRASAESVPADDPEITEWAMNLGDPFGHWLLDLMLR
FT                   LPQQIETANANPAEGALFYLGRANGQIELARRYLQDVLNVDELPSWMEASDDLFRQWRV
FT                   ITTTTGRDRFVESQY"
     MLTPIRVRGR RKKALAQNSN HAQGGKARPS GPKGGRPLMS REARLDSSQA RNNKRARLWA        60
     ARPSKRRKTL SLLETLPVEL IEKIFLYSLN VNLPRASPSL AAAVSSERIY RMLILLGFWN       120
     DSASEAEDPD SAISRILRPL DYAPLQDDDR ENLQTSVLRC RWCTMPRLLM QLSDMTNLTI       180
     QRHWVNAGIE MTRDQQESLD RFLARENDTS TYEGTDKDGN HYTLSITPFV SINIACQETD       240
     EQQTHKILSI KHFPEKLLLG ASGEGFSDDH ATHLEIMRVA CGLSRSDHLE TDVSVSRESL       300
     HQGVHIALVE HNTRALATLL KIDEYIFRSN AAVAGGLPYS IPPEHFRTAV RVARNDPALF       360
     QTLLRASAES VPADDPEITE WAMNLGDPFG HWLLDLMLRL PQQIETANAN PAEGALFYLG       420
     RANGQIELAR RYLQDVLNVD ELPSWMEASD DLFRQWRVIT TTTGRDRFVE SQY              473
//

If you have problems or comments...

PBIL Back to PBIL home page