(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE266

ASFUM1_6.PE266       Location/Qualifiers
FT   CDS             join(complement(842568..842693),complement(842184..842483))
FT                   /codon_start=1
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264315"
FT                   /orf_name="AFUA_6G03830"
FT                   /product="Ribosomal protein L14"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85656.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003E614E"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD82"
FT                   /transl_table=1
FT                   /translation="MADIDVKVAQWKLVEVGRVVLIRSGPYTGKLAAIVEIIDHKRVLV
FT                   DGPSTEENKIVPRHALPLAHATLTPFVIPKLPRAAGTGPVKKLWEKNEIDGKWAKSTIA
FT                   QKTERAERRKNLTDFERFKVLRLKKQVRSVCETMGEL"
     MADIDVKVAQ WKLVEVGRVV LIRSGPYTGK LAAIVEIIDH KRVLVDGPST EENKIVPRHA        60
     LPLAHATLTP FVIPKLPRAA GTGPVKKLWE KNEIDGKWAK STIAQKTERA ERRKNLTDFE       120
     RFKVLRLKKQ VRSVCETMGE L                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page