(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE267

ASFUM1_6.PE267       Location/Qualifiers
FT   CDS             join(complement(844938..845225),complement(844309..844872),
FT                   complement(844032..844280))
FT                   /codon_start=1
FT                   /gene_family="HOG000201672" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264316"
FT                   /orf_name="AFUA_6G03840"
FT                   /product="ER to Golgi transport protein Yif1 "
FT                   /protein_id="EAL85655.1"
FT                   /db_xref="HOGENOM:HBG380294"
FT                   /db_xref="HOGENOM:HBG745098"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniParc:UPI000051EA65"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD83"
FT                   /transl_table=1
FT                   /translation="MYRQSFAPPPAQSPPLHHPVPQHVSTVPMMRSPPPPASQQPPSSG
FT                   YGNPYQPSPAQGGSGTYAPGFSGFINDPTAQMGFQVGKTAMAAGQEYMEQNFNRYVSIP
FT                   ALKHYFNVSNSYVLNKLALVLFPWRHKPWSRQQARLTTSSAGPNGQIAQQQYSSMFLPP
FT                   RDDLNSPDMYIPVMALVTYILLSAVLAGFRGQFHPELLGSITTTAIAVIVFEILCLKLA
FT                   MYILSINNESQLLDLVAYSGYKFVGIIATLVMSEILTPGRGTGGWVGWVVFMYTFLANA
FT                   FFLLSSPLTSFQLRSLKYVLLPDSTSDASMRAGSMHTVARSQRNRRTQFLFIYSYVIQF
FT                   IFMWVLSREGPATPASAAAKGAGSLS"
     MYRQSFAPPP AQSPPLHHPV PQHVSTVPMM RSPPPPASQQ PPSSGYGNPY QPSPAQGGSG        60
     TYAPGFSGFI NDPTAQMGFQ VGKTAMAAGQ EYMEQNFNRY VSIPALKHYF NVSNSYVLNK       120
     LALVLFPWRH KPWSRQQARL TTSSAGPNGQ IAQQQYSSMF LPPRDDLNSP DMYIPVMALV       180
     TYILLSAVLA GFRGQFHPEL LGSITTTAIA VIVFEILCLK LAMYILSINN ESQLLDLVAY       240
     SGYKFVGIIA TLVMSEILTP GRGTGGWVGW VVFMYTFLAN AFFLLSSPLT SFQLRSLKYV       300
     LLPDSTSDAS MRAGSMHTVA RSQRNRRTQF LFIYSYVIQF IFMWVLSREG PATPASAAAK       360
     GAGSLS                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page