(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE268

ASFUM1_6.PE268       Location/Qualifiers
FT   CDS             join(845529..845753,845805..846090,846149..847587)
FT                   /codon_start=1
FT                   /gene_family="HOG000201671" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903126"
FT                   /orf_name="AFUA_6G03850"
FT                   /product="Signal sequence receptor alpha subunit, putative "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="receptor activity"
FT                   /function="signal recognition particle binding "
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle receptor
FT                   complex"
FT                   /protein_id="EAL85654.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0004872"
FT                   /db_xref="GO:0005047"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005785"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007222"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI000051ECA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD84"
FT                   /transl_table=1
FT                   /translation="MLEAFEVLTTSGVVLWSKSYAPVGAHVVNSLINDVFIEEKVRAQN
FT                   QAASSAAPIYKKEKYTLKWKQVKDFNLIFVAVYQSLLHLGWIDKLLDNVSTIFIDLYKD
FT                   ELRSTRARIIEYPFDKYFDQQVRELEDNAGAPTSESLVVEINERKDPLVSSDNGGPPPP
FT                   PVPGLLKAQRPVAQGVATSDEGSPPQTPDLSRSSTPISGHLLTAKGGPAGRASRRARKA
FT                   ANASATASSGDESIRKGKTLKSGKKMRKWDADGFADEDDGKVLDYSAPADGEDAPAPVV
FT                   EAVAQESWGRRTGKGQFVLKDLGDEVHSILENADHEKTKSSSSTGFVGSGVNALGGFFR
FT                   NIVGGKVLTEADLEKPLKAMEDHLLKKNVAREAAVRLCQGVQRELVGKKTGNFQSVDAA
FT                   LRSAMESSLRKILTPTSSLDLLREIDAVRSPTSKGQAPRPYVISIVGVNGVGKSTNLGK
FT                   ICYFLLQNNYRVLIAACDTFRSGAVEQLRVHARNLKELSTRENAGEVELYEKGYGKDAA
FT                   NVAKDAVEYGAANHFDVVLIDTAGRRHNDQRLMSSLEKFAKFAKPDKIFMVGEALVGTD
FT                   SVMQARNFNQAFGTGRNLDGFIISKCDTVGDMVGTLVSMVHATGIPIVFLGVGQHYGDL
FT                   RGLSVPWAVNLLMK"
     MLEAFEVLTT SGVVLWSKSY APVGAHVVNS LINDVFIEEK VRAQNQAASS AAPIYKKEKY        60
     TLKWKQVKDF NLIFVAVYQS LLHLGWIDKL LDNVSTIFID LYKDELRSTR ARIIEYPFDK       120
     YFDQQVRELE DNAGAPTSES LVVEINERKD PLVSSDNGGP PPPPVPGLLK AQRPVAQGVA       180
     TSDEGSPPQT PDLSRSSTPI SGHLLTAKGG PAGRASRRAR KAANASATAS SGDESIRKGK       240
     TLKSGKKMRK WDADGFADED DGKVLDYSAP ADGEDAPAPV VEAVAQESWG RRTGKGQFVL       300
     KDLGDEVHSI LENADHEKTK SSSSTGFVGS GVNALGGFFR NIVGGKVLTE ADLEKPLKAM       360
     EDHLLKKNVA REAAVRLCQG VQRELVGKKT GNFQSVDAAL RSAMESSLRK ILTPTSSLDL       420
     LREIDAVRSP TSKGQAPRPY VISIVGVNGV GKSTNLGKIC YFLLQNNYRV LIAACDTFRS       480
     GAVEQLRVHA RNLKELSTRE NAGEVELYEK GYGKDAANVA KDAVEYGAAN HFDVVLIDTA       540
     GRRHNDQRLM SSLEKFAKFA KPDKIFMVGE ALVGTDSVMQ ARNFNQAFGT GRNLDGFIIS       600
     KCDTVGDMVG TLVSMVHATG IPIVFLGVGQ HYGDLRGLSV PWAVNLLMK                   649
//

If you have problems or comments...

PBIL Back to PBIL home page