(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE271

ASFUM1_6.PE271       Location/Qualifiers
FT   CDS             join(complement(854534..854711),complement(854322..854466),
FT                   complement(854189..854266),complement(854005..854019),
FT                   complement(853901..853933),complement(853633..853838),
FT                   complement(853472..853584))
FT                   /codon_start=1
FT                   /gene_family="HOG000217811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903127"
FT                   /orf_name="AFUA_6G03880"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85651.2"
FT                   /db_xref="HOGENOM:HBG056238"
FT                   /db_xref="UniParc:UPI0000F51CEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD87"
FT                   /transl_table=1
FT                   /translation="MARADIDNRSPLQAEAKRNFENQIVLSPSSHNASVALGARTRVLR
FT                   ASDVLLSLAGKTEKETLGDEDSPGVESFAETVRLFPPLTNDDGAPNGAVDSKCPDCDAV
FT                   FSSPCELKQHYLTRFCPGAAVAIYLMMRDRGSTTSCKSCGEECNISYEPVLNDPRDDIN
FT                   LRDIQKDRVNGAHSRSPSIAQKNLTGSKFHIATNTAGEQSFAQRARKLRDSWSLRKISQ
FT                   SDEDELIAVSFAGLYDLERGRSTLFSDSAVLKV"
     MARADIDNRS PLQAEAKRNF ENQIVLSPSS HNASVALGAR TRVLRASDVL LSLAGKTEKE        60
     TLGDEDSPGV ESFAETVRLF PPLTNDDGAP NGAVDSKCPD CDAVFSSPCE LKQHYLTRFC       120
     PGAAVAIYLM MRDRGSTTSC KSCGEECNIS YEPVLNDPRD DINLRDIQKD RVNGAHSRSP       180
     SIAQKNLTGS KFHIATNTAG EQSFAQRARK LRDSWSLRKI SQSDEDELIA VSFAGLYDLE       240
     RGRSTLFSDS AVLKV                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page