(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE273

ASFUM1_6.PE273       Location/Qualifiers
FT   CDS             join(complement(860621..862946),complement(859681..860560),
FT                   complement(859559..859578),complement(859391..859473))
FT                   /codon_start=1
FT                   /gene_family="HOG000201627" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264319"
FT                   /orf_name="AFUA_6G03900"
FT                   /product="F-box domain protein"
FT                   /protein_id="EAL85649.1"
FT                   /db_xref="HOGENOM:HBG056237"
FT                   /db_xref="HOGENOM:HBG327859"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000052092B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD89"
FT                   /transl_table=1
FT                   /translation="MLPSLKMSTTDPFGAPPSDSEHSITSISKCDPSPSQPSDGEWTDD
FT                   DDFAISPLSDRSPPRGNHWTRFFPELSSHFSLVSPISTTTPKVTPFSLLADMQAIDHQN
FT                   RQNSSDSGTRTDSPSLSEDTFDTTSSCYSRRSSVTSLGSELAGCPYKSADAFSVISPAA
FT                   AGVFDDDIAPMLVGPASKLAVESPSLDEVRNKPLPREPPIALAPLSVRHNGPRPFQACQ
FT                   RPSSDWPCTTNPASPATRLSHSQRTLSQAAQELENFLAGITEQRHNEPQLFSSQISNGP
FT                   LQISRGNMDMIATRPAPRPPTNIASVKSKDNSSQKISPEQPERDLQKPMKKTKYKGPFS
FT                   FSVPGFSRKYTNTHLRSFSSSSLKSEMESPSFRPQRPPRPETIHDEAEDTAEVAQSPFL
FT                   PVPSQRQRSSSFCSERELRLRLPRLQTKQVRSHEDLVSSSSSFVEAERVAERSMPSIRA
FT                   NNVEEKIFVASSKSGRSNTSDSLFELDGGMPQRMIYELDAGLPSPHPKINISVHKPSKT
FT                   TAVQLPDDIALKILEQVASLDDLFHLAVVSKQYYRVFKQHELHLMKTTVYRMSPPAWEL
FT                   REMSPPWDSEWQILVDPDAPVPEYTPTLYLQRYAQDIYTLAQLKSLILARCNTFLRQET
FT                   INGLTGKDDTRAAEIDDAFWRIWTFCRIFGCGKNRENDIVGQMDWLNGGVMAHDRNSIM
FT                   TTSLTEPFGMNNVLFEPPEGFGRGNGEGLSQSQLYDMTEIWTCLAVLLQPIHGRRTEAR
FT                   KAGVFAGLDIAENDTAKEEAMIEEWTYYVLTLGPSAVLSIGSICAFDDSEATFQTAQSI
FT                   GLTKWEPADSSISRSTFLKEAVSRAYKVREGSPSLPGSRLSNASSTSSRSSAGRKTTSQ
FT                   ASSNTSDSNQINRRRQAVFAAQLRNRRTQQQNNPGNPITFAEERPISSYAMIMSRLEGL
FT                   PSNQPLPPAPPRQQVASSASLTPRYYPPAPIQYSQPLLPPPPPPTANPVAYRPQVLDPV
FT                   DQAIHVMVHELGFKEEDVKWALKITDTGEGIDANAAVALLTREQERYEQRRSGRFAFRS
FT                   KSPSLLESVINSQESVNSGWRPIMILPAPVFACRFDTHYAHSLQDIYCPDTFQI"
     MLPSLKMSTT DPFGAPPSDS EHSITSISKC DPSPSQPSDG EWTDDDDFAI SPLSDRSPPR        60
     GNHWTRFFPE LSSHFSLVSP ISTTTPKVTP FSLLADMQAI DHQNRQNSSD SGTRTDSPSL       120
     SEDTFDTTSS CYSRRSSVTS LGSELAGCPY KSADAFSVIS PAAAGVFDDD IAPMLVGPAS       180
     KLAVESPSLD EVRNKPLPRE PPIALAPLSV RHNGPRPFQA CQRPSSDWPC TTNPASPATR       240
     LSHSQRTLSQ AAQELENFLA GITEQRHNEP QLFSSQISNG PLQISRGNMD MIATRPAPRP       300
     PTNIASVKSK DNSSQKISPE QPERDLQKPM KKTKYKGPFS FSVPGFSRKY TNTHLRSFSS       360
     SSLKSEMESP SFRPQRPPRP ETIHDEAEDT AEVAQSPFLP VPSQRQRSSS FCSERELRLR       420
     LPRLQTKQVR SHEDLVSSSS SFVEAERVAE RSMPSIRANN VEEKIFVASS KSGRSNTSDS       480
     LFELDGGMPQ RMIYELDAGL PSPHPKINIS VHKPSKTTAV QLPDDIALKI LEQVASLDDL       540
     FHLAVVSKQY YRVFKQHELH LMKTTVYRMS PPAWELREMS PPWDSEWQIL VDPDAPVPEY       600
     TPTLYLQRYA QDIYTLAQLK SLILARCNTF LRQETINGLT GKDDTRAAEI DDAFWRIWTF       660
     CRIFGCGKNR ENDIVGQMDW LNGGVMAHDR NSIMTTSLTE PFGMNNVLFE PPEGFGRGNG       720
     EGLSQSQLYD MTEIWTCLAV LLQPIHGRRT EARKAGVFAG LDIAENDTAK EEAMIEEWTY       780
     YVLTLGPSAV LSIGSICAFD DSEATFQTAQ SIGLTKWEPA DSSISRSTFL KEAVSRAYKV       840
     REGSPSLPGS RLSNASSTSS RSSAGRKTTS QASSNTSDSN QINRRRQAVF AAQLRNRRTQ       900
     QQNNPGNPIT FAEERPISSY AMIMSRLEGL PSNQPLPPAP PRQQVASSAS LTPRYYPPAP       960
     IQYSQPLLPP PPPPTANPVA YRPQVLDPVD QAIHVMVHEL GFKEEDVKWA LKITDTGEGI      1020
     DANAAVALLT REQERYEQRR SGRFAFRSKS PSLLESVINS QESVNSGWRP IMILPAPVFA      1080
     CRFDTHYAHS LQDIYCPDTF QI                                               1102
//

If you have problems or comments...

PBIL Back to PBIL home page