(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE274

ASFUM1_6.PE274       Location/Qualifiers
FT   CDS             join(complement(866211..866309),complement(865767..866084),
FT                   complement(865531..865680))
FT                   /codon_start=1
FT                   /gene_family="HOG000201616" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264320"
FT                   /orf_name="AFUA_6G03910"
FT                   /product="Integral membrane protein, Mpv17/PMP22 family,
FT                   putative"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EAL85648.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG327857"
FT                   /db_xref="HOGENOM:HBG472290"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI0000520466"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD90"
FT                   /transl_table=1
FT                   /translation="MSLPPIATATLQAALVNAGSNVLAQGIRAWRDETPFELDLEALFH
FT                   FTTCAFVLSPLTYVWLEGLESRFPGSSEDTSVTQSTAEKHGSKQGKQKLNVKNIVAKVV
FT                   IDQTIGGAINTVVFVMTMGLLRGQDFEVVKAQIQNDFWPIMFAGFKLWPFVSILNFTVV
FT                   PADKRLLVGSLFGVIWAVYLSLMSG"
     MSLPPIATAT LQAALVNAGS NVLAQGIRAW RDETPFELDL EALFHFTTCA FVLSPLTYVW        60
     LEGLESRFPG SSEDTSVTQS TAEKHGSKQG KQKLNVKNIV AKVVIDQTIG GAINTVVFVM       120
     TMGLLRGQDF EVVKAQIQND FWPIMFAGFK LWPFVSILNF TVVPADKRLL VGSLFGVIWA       180
     VYLSLMSG                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page