(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE275

ASFUM1_6.PE275       Location/Qualifiers
FT   CDS             join(complement(867967..868744),complement(867475..867906),
FT                   complement(867127..867413))
FT                   /codon_start=1
FT                   /gene_family="HOG000201605" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207679"
FT                   /orf_name="AFUA_6G03920"
FT                   /product="Iron-sulfur cluster-binding protein, putative "
FT                   /EC_number="1.14.-.-"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular aromatic compound metabolic
FT                   process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85647.2"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0006725"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056236"
FT                   /db_xref="HOGENOM:HBG325053"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI0000F51CEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD91"
FT                   /transl_table=1
FT                   /translation="MEALTPPTLTLVTLLTAFFFLYRAWLRAVYPKTPLIGRSELFLHV
FT                   PEADNTQAVSKESDFPENWLNSNDIFELERRAVFSKVSPNRHAQGSKFTPPNPCGSQSW
FT                   LYLSHRSQFTKPGDYQSFEVAGFPIFLILGKDGEIRAFHNVCRHRAYTVANKERGSSTV
FT                   LGCRYHGWSYNTKGELIKAPHFEQILGFDKSQNGLFAIHVQQSTDGFIFVNLEADAPGE
FT                   LLETDRLVDFVKCNGPIPQSRWIGGRAIEGVFNWKMAIVSERQFSSAVILPELARLVPS
FT                   PLLARVKHYLNGKTAGDPDVLIFPNVSFHIIKDTKYWYSLSFHPASERKTLVRYDLYCF
FT                   QNTDGDVNSQLISAKLIEMITEQVAELESQYQLRVRGAEDSSQGGVIATTTEDRDFRSC
FT                   LGKSNLQNVILEQLKRHTKLEKLQGMEVHPAMRQPRMTAKSQEADQRKSITSCSQLRSR
FT                   MIKNSFTDSSQFAESSNVMARNPQVWPGSRHSHWSDQSRK"
     MEALTPPTLT LVTLLTAFFF LYRAWLRAVY PKTPLIGRSE LFLHVPEADN TQAVSKESDF        60
     PENWLNSNDI FELERRAVFS KVSPNRHAQG SKFTPPNPCG SQSWLYLSHR SQFTKPGDYQ       120
     SFEVAGFPIF LILGKDGEIR AFHNVCRHRA YTVANKERGS STVLGCRYHG WSYNTKGELI       180
     KAPHFEQILG FDKSQNGLFA IHVQQSTDGF IFVNLEADAP GELLETDRLV DFVKCNGPIP       240
     QSRWIGGRAI EGVFNWKMAI VSERQFSSAV ILPELARLVP SPLLARVKHY LNGKTAGDPD       300
     VLIFPNVSFH IIKDTKYWYS LSFHPASERK TLVRYDLYCF QNTDGDVNSQ LISAKLIEMI       360
     TEQVAELESQ YQLRVRGAED SSQGGVIATT TEDRDFRSCL GKSNLQNVIL EQLKRHTKLE       420
     KLQGMEVHPA MRQPRMTAKS QEADQRKSIT SCSQLRSRMI KNSFTDSSQF AESSNVMARN       480
     PQVWPGSRHS HWSDQSRK                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page