(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE277

ASFUM1_6.PE277       Location/Qualifiers
FT   CDS             join(871289..871441,871521..872910,872969..873231,
FT                   873282..873600,873658..873998)
FT                   /codon_start=1
FT                   /gene_family="HOG000201594" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056387"
FT                   /orf_name="AFUA_6G03940"
FT                   /product="GTPase activating protein (Gyp7), putative "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="EAL85645.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG056234"
FT                   /db_xref="HOGENOM:HBG327854"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI0000520465"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD93"
FT                   /transl_table=1
FT                   /translation="MAGSGTKFTPPPSPPSPTASFYDVSDAEEDEYNSISSTSGRGVKL
FT                   LFSKSKVYVHPTPSSKDNIPGFIALLQQKPAPTPSSDIASTNSAKTTADLSSYLLAWVP
FT                   ESSLGDAYSTYVKVDLSGDSSPPKQRYLVPPLPTTTTYKDPIGLYAFAVPLSEIYSLLV
FT                   RPPSLGWWFGSLVINTRAGDSFPALFFHDSECESTILQKKKRTRESFDPFDENGGLFWG
FT                   GDEVLRWLRKYVEVQRSSVDNSVYLINPCEEDRISFARPLSSYDGSVTKQGHDAAAGPH
FT                   QPGGSAGRDAGMDPFMKALKETRWKVLEQLSKITTFTRRTANELADNTMIPPQVRRLMK
FT                   SPEIQTLQDEFDSARLYLARWAMSIAEQSERERAQRIWTARDVLEMENSSVGDFEILEL
FT                   ETGTMAIQERRRTVTLQEWEDFFDATTGRLNVTVDEVKERIFHGGLDPNDGVRKDAWLF
FT                   LLGVYPWDSSRDERQALMNSKRDEYIRLKGAWWERMIEGSSTTEQYEWWKEQKNRIEKD
FT                   VHRTDRTIPLFAGEDIPHPDPDSPFADVGTNVHLEQMKDMLLTYNEYNPDLGYVQGMSD
FT                   LLAPIYAVMQDDAVAFWAFVGFMDRMERNFLRDQSGMRAQLLTLDHLVQLMDPQLYLHL
FT                   QSADSTNFFFFFRMLLVWYKREFEWVDILRLWETLWTDYFSSSFHLFVALAILEKHRDV
FT                   IMDHLKHFDEVLKYVNELSNTMELVPILTRAESLFRRFERTVEAIDKKNNFPAPSTHQR
FT                   KPTQESALNKGKSPQRPQSVGYSSGVSAGPASSSAAGDNAESKVISPELRQLLSKEILW
FT                   KQPHPTSSK"
     MAGSGTKFTP PPSPPSPTAS FYDVSDAEED EYNSISSTSG RGVKLLFSKS KVYVHPTPSS        60
     KDNIPGFIAL LQQKPAPTPS SDIASTNSAK TTADLSSYLL AWVPESSLGD AYSTYVKVDL       120
     SGDSSPPKQR YLVPPLPTTT TYKDPIGLYA FAVPLSEIYS LLVRPPSLGW WFGSLVINTR       180
     AGDSFPALFF HDSECESTIL QKKKRTRESF DPFDENGGLF WGGDEVLRWL RKYVEVQRSS       240
     VDNSVYLINP CEEDRISFAR PLSSYDGSVT KQGHDAAAGP HQPGGSAGRD AGMDPFMKAL       300
     KETRWKVLEQ LSKITTFTRR TANELADNTM IPPQVRRLMK SPEIQTLQDE FDSARLYLAR       360
     WAMSIAEQSE RERAQRIWTA RDVLEMENSS VGDFEILELE TGTMAIQERR RTVTLQEWED       420
     FFDATTGRLN VTVDEVKERI FHGGLDPNDG VRKDAWLFLL GVYPWDSSRD ERQALMNSKR       480
     DEYIRLKGAW WERMIEGSST TEQYEWWKEQ KNRIEKDVHR TDRTIPLFAG EDIPHPDPDS       540
     PFADVGTNVH LEQMKDMLLT YNEYNPDLGY VQGMSDLLAP IYAVMQDDAV AFWAFVGFMD       600
     RMERNFLRDQ SGMRAQLLTL DHLVQLMDPQ LYLHLQSADS TNFFFFFRML LVWYKREFEW       660
     VDILRLWETL WTDYFSSSFH LFVALAILEK HRDVIMDHLK HFDEVLKYVN ELSNTMELVP       720
     ILTRAESLFR RFERTVEAID KKNNFPAPST HQRKPTQESA LNKGKSPQRP QSVGYSSGVS       780
     AGPASSSAAG DNAESKVISP ELRQLLSKEI LWKQPHPTSS K                           821
//

If you have problems or comments...

PBIL Back to PBIL home page