(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE282

ASFUM1_6.PE282       Location/Qualifiers
FT   CDS             890356..894840
FT                   /codon_start=1
FT                   /gene_family="HOG000201583" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056389"
FT                   /orf_name="AFUA_6G03990"
FT                   /product="GAS2 domain protein"
FT                   /biological_process="cell cycle arrest"
FT                   /protein_id="EAL85640.1"
FT                   /db_xref="GO:0007050"
FT                   /db_xref="HOGENOM:HBG056231"
FT                   /db_xref="InterPro:IPR003108"
FT                   /db_xref="UniParc:UPI000051F8D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WD98"
FT                   /transl_table=1
FT                   /translation="MATSRVSPVRPSVRFSPTESHHYRKRSLSRSPDRSAAPKYETIDP
FT                   LLSNLSPESTLLALTSTDAVPKNEKAAHDILWKSISQVSPAERALGIRAAIAAQRLGEW
FT                   YREVQAWDWPKRADAELGKGFMPPSSSNVNSEEQGYYGSLPSVVVKQHEDRIEEIRDGM
FT                   ETLDVDELKEHVLNAHIPARSRPSSSNSTVSVPPPLTYVQLSDFTAVITATILRALPLL
FT                   SRLNNLLTTWDVRLLVLRQIPGLLRALHLAQSEVDSAMDLLKATAPPSENDPLYSRENY
FT                   HAKRTSLEAIVLSAGRRMDIVLDALEGREDSLPESWIDELEAVESDFSTWVMEAEKRTV
FT                   ENEWLRMRSTTSESKEAQRVQNKQNRLSNIPEEEDSKFPVADSSDPSPQSSCSLPMETI
FT                   NEGDGDQLLVEAISDAVTHNQNSAQGLNALDPSQSHLDSSEFVSLSGPDTKISNEPSEQ
FT                   STIEIAIDAVLPVDVDMPRPESSEIVKSFSEDSSDDSIGGSSDKPSNDRPSQSTPSVCQ
FT                   IRPAVSEAASEEVSLEELVAAATQRHGNTTVLQIPEQGRSTSIEQSSGEMTDDTSSSKK
FT                   HQAPRDLQCSLPIDHFVANRPGAECLSVSSELVPENTYLVSHVEEKLCSSQLSASAQEV
FT                   SSIATRLADSSYKEHKVPLKEPSFATTKNDSFRIAESETPSLRTTGTSMEQTDAVCGIN
FT                   ENQTSSTTAGDNSQEERKQFSDGLSAVATPSDSGRQLSVEPLEDKVAPTVSSNLAEVAF
FT                   TEETSAAELLDRQGLNVDIGRAIDPFDSEKSSPIENEAATLASVIAEAATTRAPSTSTS
FT                   LKREESFSRSATSSPEPAKPVSNSRNDKASAVDPGEPQQSSETVPPPKIRLESPIKLSK
FT                   TRPQSLNISKGNSKSQARRTSTASAGSLSDYPSLTSSPGIREPRTASSNGTPLLLETPP
FT                   PFQDLSLASDYVSVGTDHTLREERLRRLDNQKVPNATVSHNRALSLPLQRFINERLDMQ
FT                   YESGAGGDLNGALGYRRASVASIDLRPQSEQHATDLQSSKDGSTVPTNNLKLLASQHME
FT                   LSQRRQSTSKLDDATPKPSKAWANNANAFARDSVIPSPSLESTVRNDTVRIRKQMITHP
FT                   SLENIGAYHSNVQPLRDTGFPRMETSRPSTPSKQMRRPKNQLDEKISSILDTIPARIHL
FT                   ISSEDHDFDEASVAPSLPVKHGERFRSMTPQGTLSRSGTPTPSLTLTAAPSRRRHSHAP
FT                   EDGSVKLYHLHRGGKAAPTKLFIRTVGEKGERVMVRVGGGWADLAEYLREYAIHHGCRA
FT                   VSETPRAEVQGPSSREPPARTSPGSTLTPTANTGRRTPSRPASVISNRPSSSLAVRKTR
FT                   RVSNVSDRPDLRSVSAGHAFVTSYSPLSTVSSRRRLSTSSTNSFGATSFASENHRATFA
FT                   NSPSIPLGLAGPKPRSRRVSISPESEAWVEDVLGQARRSSSSRPVKYVLPPNEQEPVSA
FT                   SARTLPKSRSISDIGRAGSSRRVALRGLGNPRD"
     MATSRVSPVR PSVRFSPTES HHYRKRSLSR SPDRSAAPKY ETIDPLLSNL SPESTLLALT        60
     STDAVPKNEK AAHDILWKSI SQVSPAERAL GIRAAIAAQR LGEWYREVQA WDWPKRADAE       120
     LGKGFMPPSS SNVNSEEQGY YGSLPSVVVK QHEDRIEEIR DGMETLDVDE LKEHVLNAHI       180
     PARSRPSSSN STVSVPPPLT YVQLSDFTAV ITATILRALP LLSRLNNLLT TWDVRLLVLR       240
     QIPGLLRALH LAQSEVDSAM DLLKATAPPS ENDPLYSREN YHAKRTSLEA IVLSAGRRMD       300
     IVLDALEGRE DSLPESWIDE LEAVESDFST WVMEAEKRTV ENEWLRMRST TSESKEAQRV       360
     QNKQNRLSNI PEEEDSKFPV ADSSDPSPQS SCSLPMETIN EGDGDQLLVE AISDAVTHNQ       420
     NSAQGLNALD PSQSHLDSSE FVSLSGPDTK ISNEPSEQST IEIAIDAVLP VDVDMPRPES       480
     SEIVKSFSED SSDDSIGGSS DKPSNDRPSQ STPSVCQIRP AVSEAASEEV SLEELVAAAT       540
     QRHGNTTVLQ IPEQGRSTSI EQSSGEMTDD TSSSKKHQAP RDLQCSLPID HFVANRPGAE       600
     CLSVSSELVP ENTYLVSHVE EKLCSSQLSA SAQEVSSIAT RLADSSYKEH KVPLKEPSFA       660
     TTKNDSFRIA ESETPSLRTT GTSMEQTDAV CGINENQTSS TTAGDNSQEE RKQFSDGLSA       720
     VATPSDSGRQ LSVEPLEDKV APTVSSNLAE VAFTEETSAA ELLDRQGLNV DIGRAIDPFD       780
     SEKSSPIENE AATLASVIAE AATTRAPSTS TSLKREESFS RSATSSPEPA KPVSNSRNDK       840
     ASAVDPGEPQ QSSETVPPPK IRLESPIKLS KTRPQSLNIS KGNSKSQARR TSTASAGSLS       900
     DYPSLTSSPG IREPRTASSN GTPLLLETPP PFQDLSLASD YVSVGTDHTL REERLRRLDN       960
     QKVPNATVSH NRALSLPLQR FINERLDMQY ESGAGGDLNG ALGYRRASVA SIDLRPQSEQ      1020
     HATDLQSSKD GSTVPTNNLK LLASQHMELS QRRQSTSKLD DATPKPSKAW ANNANAFARD      1080
     SVIPSPSLES TVRNDTVRIR KQMITHPSLE NIGAYHSNVQ PLRDTGFPRM ETSRPSTPSK      1140
     QMRRPKNQLD EKISSILDTI PARIHLISSE DHDFDEASVA PSLPVKHGER FRSMTPQGTL      1200
     SRSGTPTPSL TLTAAPSRRR HSHAPEDGSV KLYHLHRGGK AAPTKLFIRT VGEKGERVMV      1260
     RVGGGWADLA EYLREYAIHH GCRAVSETPR AEVQGPSSRE PPARTSPGST LTPTANTGRR      1320
     TPSRPASVIS NRPSSSLAVR KTRRVSNVSD RPDLRSVSAG HAFVTSYSPL STVSSRRRLS      1380
     TSSTNSFGAT SFASENHRAT FANSPSIPLG LAGPKPRSRR VSISPESEAW VEDVLGQARR      1440
     SSSSRPVKYV LPPNEQEPVS ASARTLPKSR SISDIGRAGS SRRVALRGLG NPRD            1494
//

If you have problems or comments...

PBIL Back to PBIL home page