(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE285

ASFUM1_6.PE285       Location/Qualifiers
FT   CDS             join(complement(905631..905849),complement(905149..905556))
FT                   /codon_start=1
FT                   /gene_family="HOG000217812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751082"
FT                   /orf_name="AFUA_6G04020"
FT                   /product="Peptidyl-tRNA hydrolase domain protein "
FT                   /function="hydrolase activity"
FT                   /function="translation release factor activity "
FT                   /protein_id="EAL85637.1"
FT                   /db_xref="GO:0003747"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG056229"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniParc:UPI0000520453"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA1"
FT                   /transl_table=1
FT                   /translation="MPHPATPTTLQQSLSILRTSLLPKAIHPPPSLRRSFTLASSLSAK
FT                   QLPPRLKIDDADLTVSYLKGTGPGGQKINKTNSAVQLIHKPTGIVVKSQATRSRSQNEK
FT                   IARQILADKVEELLKGDASRNAIRAERARKKKASKMKKTRRKYRELGKGAQNEKHEDGD
FT                   EVDVEDDTGDGSEVQGAPHVSRCDAEDSTTQKTCDNHAAEQKQLG"
     MPHPATPTTL QQSLSILRTS LLPKAIHPPP SLRRSFTLAS SLSAKQLPPR LKIDDADLTV        60
     SYLKGTGPGG QKINKTNSAV QLIHKPTGIV VKSQATRSRS QNEKIARQIL ADKVEELLKG       120
     DASRNAIRAE RARKKKASKM KKTRRKYREL GKGAQNEKHE DGDEVDVEDD TGDGSEVQGA       180
     PHVSRCDAED STTQKTCDNH AAEQKQLG                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page