(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE286

ASFUM1_6.PE286       Location/Qualifiers
FT   CDS             complement(908793..909044)
FT                   /codon_start=1
FT                   /gene_family="HOG000201340" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207682"
FT                   /orf_name="AFUA_6G04030"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85636.1"
FT                   /db_xref="HOGENOM:HBG056228"
FT                   /db_xref="UniParc:UPI000051FB57"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA2"
FT                   /transl_table=1
FT                   /translation="MYVIFPIGWMYYFGTNLDERFSVPGFWPTAEQSHKIPFEKEEIDR
FT                   ELARMRTVDAVRRERRLRREAMEAQAQAQVAAQVENAE"
     MYVIFPIGWM YYFGTNLDER FSVPGFWPTA EQSHKIPFEK EEIDRELARM RTVDAVRRER        60
     RLRREAMEAQ AQAQVAAQVE NAE                                                83
//

If you have problems or comments...

PBIL Back to PBIL home page