(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE29

ASFUM1_6.PE29        Location/Qualifiers
FT   CDS             complement(101721..102860)
FT                   /codon_start=1
FT                   /gene_family="HOG000217782" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20750571"
FT                   /orf_name="AFUA_6G00400"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL84225.1"
FT                   /db_xref="HOGENOM:HBG056353"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI000051E42A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z4"
FT                   /transl_table=1
FT                   /translation="MHHFVTQTIRVLFPLAPPVFGQTLVATAMETPHLLHALLAASCSH
FT                   YARLVQKPSAHQLTVLKFTNLAVAGLRAALADPTETLRPETAMTAMVLCTNDVCNGNAR
FT                   TWKVHLSGVTQLLTALLARHKTADGDPDPFFLCLLKWFAALDILAGLSGTHEGCVNDGQ
FT                   YWNLTRNPNCGNGHVDEICGYSTQLMPLLARIGQLARRNVHEQSIFETYTEPSSALSEE
FT                   LTHDAQDLETRILSIANQVPSAATLAFHDQVLASELHNTHLAFIHSALLHLYRRVELLP
FT                   KSHPKVRAQVTAILYNVQAIKPFSPANALILWPIFSAGCETDDLQERQAIQTRMANMQT
FT                   MGLGNFTRARDALARYWESGASSRWDVYFAQSGLELVLF"
     MHHFVTQTIR VLFPLAPPVF GQTLVATAME TPHLLHALLA ASCSHYARLV QKPSAHQLTV        60
     LKFTNLAVAG LRAALADPTE TLRPETAMTA MVLCTNDVCN GNARTWKVHL SGVTQLLTAL       120
     LARHKTADGD PDPFFLCLLK WFAALDILAG LSGTHEGCVN DGQYWNLTRN PNCGNGHVDE       180
     ICGYSTQLMP LLARIGQLAR RNVHEQSIFE TYTEPSSALS EELTHDAQDL ETRILSIANQ       240
     VPSAATLAFH DQVLASELHN THLAFIHSAL LHLYRRVELL PKSHPKVRAQ VTAILYNVQA       300
     IKPFSPANAL ILWPIFSAGC ETDDLQERQA IQTRMANMQT MGLGNFTRAR DALARYWESG       360
     ASSRWDVYFA QSGLELVLF                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page