(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE291

ASFUM1_6.PE291       Location/Qualifiers
FT   CDS             join(complement(921197..923644),complement(920785..921147),
FT                   complement(919459..920736),complement(918820..919401),
FT                   complement(917192..918763))
FT                   /codon_start=1
FT                   /gene_family="HOG000201373" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056390"
FT                   /orf_name="AFUA_6G04080"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85631.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056224"
FT                   /db_xref="HOGENOM:HBG327840"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051EF08"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA7"
FT                   /transl_table=1
FT                   /translation="MSSSENATTPAASDNAAPRAELDITKLHALPSEQQDLYLLTFTSD
FT                   LVQYISDLDSASVSLQQKSLKKELFKILTLSSPTITRVIRNNLGRSFGAILGKGDRGIL
FT                   FETVTDLLAILNAGKNEAELKTKFAAAHCLGEVFAVAGESVFAQSGTVASGLLKLLKSS
FT                   SNHTGLRGSTFAILRKVVVGAGVPVDEGTARDIWKQARNAATSDKSTFVQVHACRCLEQ
FT                   LVKTTPFFDNANDFDHLKTLIWKVIDSNVAPVRHAAAACLAQALVKLHASDARVTAVPK
FT                   PKKMKRQSKKPAPRPGEDDDEAEVSEPSVSKKAEPGLYFLLPDLLRQLSTQYMKSTTSN
FT                   RARAGIAACYKYVLRSLGDKLVEERYGQIANHLLFELLNHPTVTYNRFRLLMTRRFVKG
FT                   ILEETVGRETLRENSQLNAAKWLINEILKDYPQVLQERREPSKYTLASTLSALSSLISS
FT                   LGSAFGAMAEACREALLQVLPHPSYTVQIHAAHCLRNFVLACPHQLISCVTICLNSLSR
FT                   EIGQLSTPRQAPRRCVGYANGLSAMLSTSRLQPLYGSVDVFSRVFTQATDLLKTSGKSE
FT                   LRAASTQVQVAWILIGGLMPLGPSFVKIHLSQLMLLWKNALPKHLGKDNIAQRGYLEMS
FT                   FLAHVRECALGSLLVFMDFNSKLITADGARRIAAMLQNTIEFLDDLPRQKSVADLSQRL
FT                   QPSLQLHDLTTMVRRRVLQCFSKLIDVHPLSHADVISQTTLLSLSISSFADPEYTQPAP
FT                   LESSIAAATAQFETLWELCDNFGFGVTGLARQYIRATLSGKQDNENGPAWSAVDLSDQD
FT                   IDDAQLTFPICQASEHDSLLLYSSRSERDSVLADPHATGVVNAAIELFAVAIPLYAPKV
FT                   QESTMEQIATFLSSQSLQRNPGRKAAMIVNIAVALLHALKIAAKDSGSASGRLSPVTEK
FT                   VLQELLQKFVVDADPIVRTIGAEALGRLCDGAGNTLMTTQVNWLVDTIVDNREPNARAG
FT                   CAAALGCIHAQVGGMAAGLHLKTIVGVLMSLCNDPHPVVHFWALGGLERVANSAGLTFS
FT                   PFVSSALGMLAQLYNADTHNEEAASLATSNIEMTFLTPVVISRCVDSLINVLGPDLQDI
FT                   TKTRNLILTLLRQFQLEDNPALVTESSKCLDHMSLYAPGFVDFSGFVTRLQNELSAGNP
FT                   LMRDVAIRALSNLMKRDATSVLRAATPDLEEQIWLAYDDTPDNLVLKNMILDWLQHTAL
FT                   TETEQWIQRCQNTLTKTRLKVEDIPPTSAVKTAVNDMPDDEVAGFAYAIAGAGQSETVN
FT                   ETVTGQELLKWQTRNFVMSCLSQLLATVQEAILPDQTIPAELALQHKVGDIVRMAFSAS
FT                   TANVVELRVWGLKIIDQVLKMFGKTPDPDFAEASLLEQYQAQIGSALTPAFAADSSPEL
FT                   ASEAINVSATFIATGIVTNVERMGRILKVLVLGLENFSSKCKVEVFLKVCSPSPENPDT
FT                   TEFGDLKGLNSNAKVMVKMALFAAWARLQIASIDQDYLNEVVQPYLATLTPLWLSSLQE
FT                   YARLRFEPDISGSLGTGPQSTNLDEVYAALNRETLLKFYQDSWLSLVDAIAGLVEKDID
FT                   FVFDALDGKTTEPKDREEEKANMPNGKAVDKKHDINYRDEPVAFFFVLFGLAFEALVDQ
FT                   STTPSQRLDILQALKRILRPVISGNAIYQDAIFSETMDTFDRLALTEGTPIQTVIVEIA
FT                   RNLSLDHPSAKAGDARSDHLSDDIEQLFELTRSIILVLAGLLPNLGENTSVARFNVTSD
FT                   DSLSLIRLVLSSLVQVASIFPSIIRNDLNACILHIFTTILATGLCQAEVVPQALPTFKH
FT                   FIHGIIHPKASVSDEAQDLAIVSHQLRGCLTRFLTTLTIAQRRESESSLPCAKNTLLAI
FT                   TILLTTGGHILPPQDPAIPRVLNELLDCLQDVGLANVAAGCIRSILLTSTSRSPTNDLI
FT                   AKYLLPRLIAFLVGCPLDKGEIPSDPENSRTVIARTLVSYATSATFAASELPTAFSIVM
FT                   SALLARAKRESYPVYRETAAHLLELARADQATFRALVASMKPDQKGLLEEILRSSDPGT
FT                   GAGAGRAETNGAQSEASQSMPSIALRLDF"
     MSSSENATTP AASDNAAPRA ELDITKLHAL PSEQQDLYLL TFTSDLVQYI SDLDSASVSL        60
     QQKSLKKELF KILTLSSPTI TRVIRNNLGR SFGAILGKGD RGILFETVTD LLAILNAGKN       120
     EAELKTKFAA AHCLGEVFAV AGESVFAQSG TVASGLLKLL KSSSNHTGLR GSTFAILRKV       180
     VVGAGVPVDE GTARDIWKQA RNAATSDKST FVQVHACRCL EQLVKTTPFF DNANDFDHLK       240
     TLIWKVIDSN VAPVRHAAAA CLAQALVKLH ASDARVTAVP KPKKMKRQSK KPAPRPGEDD       300
     DEAEVSEPSV SKKAEPGLYF LLPDLLRQLS TQYMKSTTSN RARAGIAACY KYVLRSLGDK       360
     LVEERYGQIA NHLLFELLNH PTVTYNRFRL LMTRRFVKGI LEETVGRETL RENSQLNAAK       420
     WLINEILKDY PQVLQERREP SKYTLASTLS ALSSLISSLG SAFGAMAEAC REALLQVLPH       480
     PSYTVQIHAA HCLRNFVLAC PHQLISCVTI CLNSLSREIG QLSTPRQAPR RCVGYANGLS       540
     AMLSTSRLQP LYGSVDVFSR VFTQATDLLK TSGKSELRAA STQVQVAWIL IGGLMPLGPS       600
     FVKIHLSQLM LLWKNALPKH LGKDNIAQRG YLEMSFLAHV RECALGSLLV FMDFNSKLIT       660
     ADGARRIAAM LQNTIEFLDD LPRQKSVADL SQRLQPSLQL HDLTTMVRRR VLQCFSKLID       720
     VHPLSHADVI SQTTLLSLSI SSFADPEYTQ PAPLESSIAA ATAQFETLWE LCDNFGFGVT       780
     GLARQYIRAT LSGKQDNENG PAWSAVDLSD QDIDDAQLTF PICQASEHDS LLLYSSRSER       840
     DSVLADPHAT GVVNAAIELF AVAIPLYAPK VQESTMEQIA TFLSSQSLQR NPGRKAAMIV       900
     NIAVALLHAL KIAAKDSGSA SGRLSPVTEK VLQELLQKFV VDADPIVRTI GAEALGRLCD       960
     GAGNTLMTTQ VNWLVDTIVD NREPNARAGC AAALGCIHAQ VGGMAAGLHL KTIVGVLMSL      1020
     CNDPHPVVHF WALGGLERVA NSAGLTFSPF VSSALGMLAQ LYNADTHNEE AASLATSNIE      1080
     MTFLTPVVIS RCVDSLINVL GPDLQDITKT RNLILTLLRQ FQLEDNPALV TESSKCLDHM      1140
     SLYAPGFVDF SGFVTRLQNE LSAGNPLMRD VAIRALSNLM KRDATSVLRA ATPDLEEQIW      1200
     LAYDDTPDNL VLKNMILDWL QHTALTETEQ WIQRCQNTLT KTRLKVEDIP PTSAVKTAVN      1260
     DMPDDEVAGF AYAIAGAGQS ETVNETVTGQ ELLKWQTRNF VMSCLSQLLA TVQEAILPDQ      1320
     TIPAELALQH KVGDIVRMAF SASTANVVEL RVWGLKIIDQ VLKMFGKTPD PDFAEASLLE      1380
     QYQAQIGSAL TPAFAADSSP ELASEAINVS ATFIATGIVT NVERMGRILK VLVLGLENFS      1440
     SKCKVEVFLK VCSPSPENPD TTEFGDLKGL NSNAKVMVKM ALFAAWARLQ IASIDQDYLN      1500
     EVVQPYLATL TPLWLSSLQE YARLRFEPDI SGSLGTGPQS TNLDEVYAAL NRETLLKFYQ      1560
     DSWLSLVDAI AGLVEKDIDF VFDALDGKTT EPKDREEEKA NMPNGKAVDK KHDINYRDEP      1620
     VAFFFVLFGL AFEALVDQST TPSQRLDILQ ALKRILRPVI SGNAIYQDAI FSETMDTFDR      1680
     LALTEGTPIQ TVIVEIARNL SLDHPSAKAG DARSDHLSDD IEQLFELTRS IILVLAGLLP      1740
     NLGENTSVAR FNVTSDDSLS LIRLVLSSLV QVASIFPSII RNDLNACILH IFTTILATGL      1800
     CQAEVVPQAL PTFKHFIHGI IHPKASVSDE AQDLAIVSHQ LRGCLTRFLT TLTIAQRRES      1860
     ESSLPCAKNT LLAITILLTT GGHILPPQDP AIPRVLNELL DCLQDVGLAN VAAGCIRSIL      1920
     LTSTSRSPTN DLIAKYLLPR LIAFLVGCPL DKGEIPSDPE NSRTVIARTL VSYATSATFA      1980
     ASELPTAFSI VMSALLARAK RESYPVYRET AAHLLELARA DQATFRALVA SMKPDQKGLL      2040
     EEILRSSDPG TGAGAGRAET NGAQSEASQS MPSIALRLDF                            2080
//

If you have problems or comments...

PBIL Back to PBIL home page