(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE292

ASFUM1_6.PE292       Location/Qualifiers
FT   CDS             join(923914..924127,924186..924811)
FT                   /codon_start=1
FT                   /gene_family="HOG000228370" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264325"
FT                   /orf_name="AFUA_6G04090"
FT                   /product="DUF28 domain protein"
FT                   /protein_id="EAL85630.2"
FT                   /db_xref="HOGENOM:HBG056223"
FT                   /db_xref="HOGENOM:HBG325050"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="UniParc:UPI0000F51CD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA8"
FT                   /transl_table=1
FT                   /translation="MASIVSQRLLLPQRCRTRHSVCEICRSFSSRAPLLAGHNRWSQIK
FT                   HDKAKNDKAKSRERQTIAKEISSATQMWGADPKFNPRLTLALSNAKRAGIPKTVIEAAI
FT                   ARGQGISVTGEALESVTIEAILPHSVAAVIECQTDQKARVLQDLRYAIKDAGGTVTPTT
FT                   YLFEKKGRIIFEKKDGVNPDDYLDQVIEAGAIDVATDDEDRLVVFTEPTETKSVGETLT
FT                   KVTGLAIKELDIIWDPNKDTMVELNKDEQVREIEDILSTLREDPSVQDIYLNTSTQF"
     MASIVSQRLL LPQRCRTRHS VCEICRSFSS RAPLLAGHNR WSQIKHDKAK NDKAKSRERQ        60
     TIAKEISSAT QMWGADPKFN PRLTLALSNA KRAGIPKTVI EAAIARGQGI SVTGEALESV       120
     TIEAILPHSV AAVIECQTDQ KARVLQDLRY AIKDAGGTVT PTTYLFEKKG RIIFEKKDGV       180
     NPDDYLDQVI EAGAIDVATD DEDRLVVFTE PTETKSVGET LTKVTGLAIK ELDIIWDPNK       240
     DTMVELNKDE QVREIEDILS TLREDPSVQD IYLNTSTQF                              279
//

If you have problems or comments...

PBIL Back to PBIL home page