(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE293

ASFUM1_6.PE293       Location/Qualifiers
FT   CDS             join(complement(927411..927432),complement(927299..927361),
FT                   complement(926202..927229),complement(925052..926146))
FT                   /codon_start=1
FT                   /gene_family="HOG000201384" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903130"
FT                   /orf_name="AFUA_6G04100"
FT                   /product="Mis6 domain protein"
FT                   /protein_id="EAL85629.2"
FT                   /db_xref="HOGENOM:HBG056222"
FT                   /db_xref="HOGENOM:HBG325049"
FT                   /db_xref="InterPro:IPR012485"
FT                   /db_xref="UniParc:UPI0000F51CDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDA9"
FT                   /transl_table=1
FT                   /translation="MSSDQQSSPSGIEPRPSSLQDALEHLEAVAYVPSKKRYTDAGQLA
FT                   KTIASHAYESGIAPSALERLIHILTRKNLLDQGTITTLIKNLYPIDRISSKVVTQVVCC
FT                   LGPSKNKPSPATQASLLRWLILVYEFCEDRSHLAKLYAVLFNHLDMISLRKPLCHLLSI
FT                   ITRRKHVKPFRIQALMELVNAAGAEEKELIGLLNVFKNYYPDIIVGDLGALRRRGLVFK
FT                   HPDPEWTSHAKLLQDRNMEQVQAAQSSSFQVVHRGAAKRGKMEVIVPVLQTSRVSSNRT
FT                   SLEELRSVDHLIGKLDRIELPNQIISAMADNIAQKYLFLVQPESARLRLDDWLSSFFDE
FT                   QLEHAQDEERGSSESLGYILSLIVDYVRYTKDIPAPVQSFLRQYLSSWNGRDNKEEVLS
FT                   LLEYLPVQDFDILRANFLTPLEAAILGSGPFTMTVILDLYSSLIRQWGVKLRSSPSVSA
FT                   ESRPLGHLITHAELLALSILESLSVASNTGNKEPRKPAALSVLEFYCVLANLFSYAPVN
FT                   GQIRLTIPLAPTVYTLVFTPILSSISIISSVLASYKMSFETSLTSEILQVPGSTNSLYP
FT                   TELVGQFNGYVMDVCNLVWRNRGLNGDDPNALGCLLPPATTSALTQYIRELNEASRDRK
FT                   REASFFFNLSSIFSLSYHVALCNMSAGCFADIEEENNITEGKPRLRKPVTQKALSALEK
FT                   DGGVKLTWQEYRVRMLDWLDATGSRGIGNLMRSTMKALRKD"
     MSSDQQSSPS GIEPRPSSLQ DALEHLEAVA YVPSKKRYTD AGQLAKTIAS HAYESGIAPS        60
     ALERLIHILT RKNLLDQGTI TTLIKNLYPI DRISSKVVTQ VVCCLGPSKN KPSPATQASL       120
     LRWLILVYEF CEDRSHLAKL YAVLFNHLDM ISLRKPLCHL LSIITRRKHV KPFRIQALME       180
     LVNAAGAEEK ELIGLLNVFK NYYPDIIVGD LGALRRRGLV FKHPDPEWTS HAKLLQDRNM       240
     EQVQAAQSSS FQVVHRGAAK RGKMEVIVPV LQTSRVSSNR TSLEELRSVD HLIGKLDRIE       300
     LPNQIISAMA DNIAQKYLFL VQPESARLRL DDWLSSFFDE QLEHAQDEER GSSESLGYIL       360
     SLIVDYVRYT KDIPAPVQSF LRQYLSSWNG RDNKEEVLSL LEYLPVQDFD ILRANFLTPL       420
     EAAILGSGPF TMTVILDLYS SLIRQWGVKL RSSPSVSAES RPLGHLITHA ELLALSILES       480
     LSVASNTGNK EPRKPAALSV LEFYCVLANL FSYAPVNGQI RLTIPLAPTV YTLVFTPILS       540
     SISIISSVLA SYKMSFETSL TSEILQVPGS TNSLYPTELV GQFNGYVMDV CNLVWRNRGL       600
     NGDDPNALGC LLPPATTSAL TQYIRELNEA SRDRKREASF FFNLSSIFSL SYHVALCNMS       660
     AGCFADIEEE NNITEGKPRL RKPVTQKALS ALEKDGGVKL TWQEYRVRML DWLDATGSRG       720
     IGNLMRSTMK ALRKD                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page