(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE295

ASFUM1_6.PE295       Location/Qualifiers
FT   CDS             join(930498..930778,930834..930919,930978..931142,
FT                   931195..931269,931325..931569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207683"
FT                   /orf_name="AFUA_6G04120"
FT                   /product="Short chain dehydrogenase/reductase family
FT                   protein"
FT                   /EC_number="1.-.-.-"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85626.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056220"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000051F414"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB2"
FT                   /transl_table=1
FT                   /translation="MTDNPPPPDYSRPQFPAHSEPRVWLITAGDSPIGISVTRQVLKHG
FT                   DYALVGLAHTYLDLDECRREAFGEFLAEVESHRGEGWVERFKTVPLDIRMIGQCQALVA
FT                   EAVAAFGKVDILLCCTSQTLVGAVEELAASQQTLNLVKDQFETNYFGPLNIIKATLPHM
FT                   RKQKSGHIMILSSITAHIGTPGLGMYSAAGWALEGFCDVKPCIRNRPIQREAHNLPMQH
FT                   RNWYPDKLGHQCASHSSSVLSCCQSCPFVPWYIEQTGYSPAPPTDSGHGERSPKLKSSQ
FT                   LC"
     MTDNPPPPDY SRPQFPAHSE PRVWLITAGD SPIGISVTRQ VLKHGDYALV GLAHTYLDLD        60
     ECRREAFGEF LAEVESHRGE GWVERFKTVP LDIRMIGQCQ ALVAEAVAAF GKVDILLCCT       120
     SQTLVGAVEE LAASQQTLNL VKDQFETNYF GPLNIIKATL PHMRKQKSGH IMILSSITAH       180
     IGTPGLGMYS AAGWALEGFC DVKPCIRNRP IQREAHNLPM QHRNWYPDKL GHQCASHSSS       240
     VLSCCQSCPF VPWYIEQTGY SPAPPTDSGH GERSPKLKSS QLC                         283
//

If you have problems or comments...

PBIL Back to PBIL home page