(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE298

ASFUM1_6.PE298       Location/Qualifiers
FT   CDS             join(complement(936140..936298),complement(935858..936011),
FT                   complement(935064..935794))
FT                   /codon_start=1
FT                   /gene_family="HOG000201430" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264328"
FT                   /orf_name="AFUA_6G04170"
FT                   /product="Killer toxin sensitivity protein (Iki1), putative"
FT                   /protein_id="EAL85623.1"
FT                   /db_xref="HOGENOM:HBG056218"
FT                   /db_xref="HOGENOM:HBG327844"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniParc:UPI000051E5BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB5"
FT                   /transl_table=1
FT                   /translation="MAPPNISHRQTHNLLLISKLLSLRDTASPLTLLLDSLEQPATPLI
FT                   HEYIRRAKLSKVHVTLVAFETLRPFEGVDAFISARKKRPSEIVKEVGAAYQPVANVPSR
FT                   RRLILIDSINPLLRSKKTDSQFHLPTFLGSFIAPPGSSPTKAETSLIVTFHQDVPNQLC
FT                   ATPYSPSSFSVLSYLATTVIKLHSFSHILAQKAARDRSLAAPVFGLEEELDGVLLGRLD
FT                   KPTGKDSAEGVVLEMEHRRKSGRGVLEWYVLPPAARYPSNYAKEIVILLDDHPLYRPPV
FT                   EPDVGMGSSEPESTFELRLTERQRREREGVVLPYFDAQQGDGPGEGGRILYDIGEEDDF
FT                   DEEEDEL"
     MAPPNISHRQ THNLLLISKL LSLRDTASPL TLLLDSLEQP ATPLIHEYIR RAKLSKVHVT        60
     LVAFETLRPF EGVDAFISAR KKRPSEIVKE VGAAYQPVAN VPSRRRLILI DSINPLLRSK       120
     KTDSQFHLPT FLGSFIAPPG SSPTKAETSL IVTFHQDVPN QLCATPYSPS SFSVLSYLAT       180
     TVIKLHSFSH ILAQKAARDR SLAAPVFGLE EELDGVLLGR LDKPTGKDSA EGVVLEMEHR       240
     RKSGRGVLEW YVLPPAARYP SNYAKEIVIL LDDHPLYRPP VEPDVGMGSS EPESTFELRL       300
     TERQRREREG VVLPYFDAQQ GDGPGEGGRI LYDIGEEDDF DEEEDEL                     347
//

If you have problems or comments...

PBIL Back to PBIL home page