(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE30

ASFUM1_6.PE30        Location/Qualifiers
FT   CDS             join(complement(105343..105465),complement(105225..105295),
FT                   complement(105051..105164),complement(104534..104997),
FT                   complement(104446..104469),complement(104057..104382),
FT                   complement(103791..104006))
FT                   /codon_start=1
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16262217"
FT                   /orf_name="AFUA_6G00412"
FT                   /product="Amino acid permease, putative "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="EBA27170.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG325555"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000F5187F"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA92"
FT                   /transl_table=1
FT                   /translation="MLVKIKSVVNTTAHEDGMSTKMGTAQDRKDMRRVGRQQELNRNFR
FT                   FLSVLGFTAVLMCTWEAVLFGASNGLINGGKGGMIYTYLGGVAGFTFVILSMAEMASMA
FT                   PTSGGQYHWVSEFAPPSCQCILSYITGWFCVLGWHTGIAGCCYTVANMMVGVVAINYPD
FT                   TYVYKPWHVTLLVIAVALVALLFNTLLAQKLPLIEGIILVIHCFGFFGILIPLWVLSPR
FT                   PTASEVFGPIQDRGGWGNNGLACLVGLVGSIYALIGPDSAVHMSEEIRDASRVLPLGMI
FT                   WTLILNGSTGFVMIITLAFCVGDIDHVLESQTGFAFIQVFLNSTGSVRAATGMTVVIMA
FT                   MQFCAAISNVATTSRQVYAFARDKGLPFSNFLSTVNPTFIVPLNALCMSLAIVSLLSLI
FT                   NIGSSVAFNAIMSLARQLSIPHTSSPSPAFACVDGAISLCLPPAGA"
     MLVKIKSVVN TTAHEDGMST KMGTAQDRKD MRRVGRQQEL NRNFRFLSVL GFTAVLMCTW        60
     EAVLFGASNG LINGGKGGMI YTYLGGVAGF TFVILSMAEM ASMAPTSGGQ YHWVSEFAPP       120
     SCQCILSYIT GWFCVLGWHT GIAGCCYTVA NMMVGVVAIN YPDTYVYKPW HVTLLVIAVA       180
     LVALLFNTLL AQKLPLIEGI ILVIHCFGFF GILIPLWVLS PRPTASEVFG PIQDRGGWGN       240
     NGLACLVGLV GSIYALIGPD SAVHMSEEIR DASRVLPLGM IWTLILNGST GFVMIITLAF       300
     CVGDIDHVLE SQTGFAFIQV FLNSTGSVRA ATGMTVVIMA MQFCAAISNV ATTSRQVYAF       360
     ARDKGLPFSN FLSTVNPTFI VPLNALCMSL AIVSLLSLIN IGSSVAFNAI MSLARQLSIP       420
     HTSSPSPAFA CVDGAISLCL PPAGA                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page