(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE300

ASFUM1_6.PE300       Location/Qualifiers
FT   CDS             join(complement(941878..941982),complement(941819..941826),
FT                   complement(941721..941766),complement(940851..941665),
FT                   complement(940012..940796),complement(939155..939939))
FT                   /codon_start=1
FT                   /gene_family="HOG000201474" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751084"
FT                   /orf_name="AFUA_6G04190"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85621.1"
FT                   /db_xref="HOGENOM:HBG056215"
FT                   /db_xref="HOGENOM:HBG327847"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR014839"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000051F66D"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDB7"
FT                   /transl_table=1
FT                   /translation="MASRTSPDGEPSGPRFRPRDGLHVRPLNVEKGSDRFPMSDSIPPQ
FT                   TATWRNNLAALSQRRNLLFVAYSHQIYVWEPAGSFQTLGCQPEMIITPVMKEPHSSGYI
FT                   SPSFPHAINNLLVDDLGREEVLLLVTDSGNVCGYRIEAIFSALKRVAETEGNDKRPLDG
FT                   SQVDPFFVEYVQASAWGLAIHKFARLIAVSANTGLITVFAFALVNPTSKDGSDELENEP
FT                   DFMDYDQTWLDIRSNEQFAQLQRLMPDKHRTRNIKLTYTGHFSNIPSVGFYNCDLDPNG
FT                   TWMVSTDIDNKLLVWKIWESLGPFNVYHFNGSTIRSFPETLRNDAERGWAVLALDPRTF
FT                   QPIKTPEEAFGGQPLRRKKRGQVVLDITRLSNRIPDTSHLYNYFPPAVRSEPDHSVLPD
FT                   IFGADCRISNDSHTQAYSTRPKGLPQNRSSSSDSEPAGEGNLPSEAADSFDHHAADGSA
FT                   AEDEGNESDMNSDPSQRASNQDADAVGSGDNGNTNRFHNANVNFRRHRGQGPLTTAEFL
FT                   QFALLEALGGDIPGAEEYLDDNLDYSDIDEDNQEGESDDTDEEMDDAEARSSDSDAISD
FT                   TGLPAYSGSDALFRFYFPILHFSQTDIRLLPHPLAPQPSVVCGSPLRQAFTRPIVSIRA
FT                   CDRFNMVKCIPEHGIVVAASQKGRAAVIALTQSEETGLSFRIDWIVPFDSQERFGERPL
FT                   VPLLGMSVSPIQGFEMPPDVPYIPREVGDGKELHFQFTDVNHDRSKTFTPSSNIKGDSR
FT                   KIYAPTFPSGPGLRQSPTERDQQYPSTLPECHARATRAYQPEERWRGWNPSRRYRLLLM
FT                   YDDHTVMSYEFWYDWKTKFVSEEEDETDQDDVLIV"
     MASRTSPDGE PSGPRFRPRD GLHVRPLNVE KGSDRFPMSD SIPPQTATWR NNLAALSQRR        60
     NLLFVAYSHQ IYVWEPAGSF QTLGCQPEMI ITPVMKEPHS SGYISPSFPH AINNLLVDDL       120
     GREEVLLLVT DSGNVCGYRI EAIFSALKRV AETEGNDKRP LDGSQVDPFF VEYVQASAWG       180
     LAIHKFARLI AVSANTGLIT VFAFALVNPT SKDGSDELEN EPDFMDYDQT WLDIRSNEQF       240
     AQLQRLMPDK HRTRNIKLTY TGHFSNIPSV GFYNCDLDPN GTWMVSTDID NKLLVWKIWE       300
     SLGPFNVYHF NGSTIRSFPE TLRNDAERGW AVLALDPRTF QPIKTPEEAF GGQPLRRKKR       360
     GQVVLDITRL SNRIPDTSHL YNYFPPAVRS EPDHSVLPDI FGADCRISND SHTQAYSTRP       420
     KGLPQNRSSS SDSEPAGEGN LPSEAADSFD HHAADGSAAE DEGNESDMNS DPSQRASNQD       480
     ADAVGSGDNG NTNRFHNANV NFRRHRGQGP LTTAEFLQFA LLEALGGDIP GAEEYLDDNL       540
     DYSDIDEDNQ EGESDDTDEE MDDAEARSSD SDAISDTGLP AYSGSDALFR FYFPILHFSQ       600
     TDIRLLPHPL APQPSVVCGS PLRQAFTRPI VSIRACDRFN MVKCIPEHGI VVAASQKGRA       660
     AVIALTQSEE TGLSFRIDWI VPFDSQERFG ERPLVPLLGM SVSPIQGFEM PPDVPYIPRE       720
     VGDGKELHFQ FTDVNHDRSK TFTPSSNIKG DSRKIYAPTF PSGPGLRQSP TERDQQYPST       780
     LPECHARATR AYQPEERWRG WNPSRRYRLL LMYDDHTVMS YEFWYDWKTK FVSEEEDETD       840
     QDDVLIV                                                                 847
//

If you have problems or comments...

PBIL Back to PBIL home page