(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE303

ASFUM1_6.PE303       Location/Qualifiers
FT   CDS             join(complement(947760..947803),complement(946489..947605))
FT                   /codon_start=1
FT                   /gene_family="HOG000201452" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264329"
FT                   /orf_name="AFUA_6G04220"
FT                   /product="Putative uncharacterized protein "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="EAL85618.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG097646"
FT                   /db_xref="HOGENOM:HBG603845"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniParc:UPI000052092A"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC0"
FT                   /transl_table=1
FT                   /translation="MAASSERREIVIVGIVTLIEATEIAGGASGKAGGLLALWAYPSSI
FT                   VPLSYKLHADLAKEHNGKVRWGYREVGCGQIVVKGRPLNEKKDVGEKDTGSSLSLQKRS
FT                   DAAIAKLRKAKFPPDLDWIDPLLIRGYESISDPGETAQVHPYLFTTSIAKLAEEKGAEI
FT                   KLGSVTKIGYAGDAVESVTYNDKESGESRTISATDVIIAAGPWTRTVMPEAPISAMRAH
FT                   SVVIRPTKPVSAHTLFTNIEIPANFDPSKPSRPTVVSPEIYARPDETVYACGEGDQVVP
FT                   LPKTTADVEVDQRRCQDIIDQVGSISDELRDGQVCARQACYLPNVSVRGGPLIGHTGTK
FT                   GLYLAAGHTCWGIQNAPGTGKLISEFVFDGDAKSAKIGSLDPRNFL"
     MAASSERREI VIVGIVTLIE ATEIAGGASG KAGGLLALWA YPSSIVPLSY KLHADLAKEH        60
     NGKVRWGYRE VGCGQIVVKG RPLNEKKDVG EKDTGSSLSL QKRSDAAIAK LRKAKFPPDL       120
     DWIDPLLIRG YESISDPGET AQVHPYLFTT SIAKLAEEKG AEIKLGSVTK IGYAGDAVES       180
     VTYNDKESGE SRTISATDVI IAAGPWTRTV MPEAPISAMR AHSVVIRPTK PVSAHTLFTN       240
     IEIPANFDPS KPSRPTVVSP EIYARPDETV YACGEGDQVV PLPKTTADVE VDQRRCQDII       300
     DQVGSISDEL RDGQVCARQA CYLPNVSVRG GPLIGHTGTK GLYLAAGHTC WGIQNAPGTG       360
     KLISEFVFDG DAKSAKIGSL DPRNFL                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page