(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE309

ASFUM1_6.PE309       Location/Qualifiers
FT   CDS             join(960907..961462,961522..962621)
FT                   /codon_start=1
FT                   /gene_family="HOG000201550" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI16264333"
FT                   /orf_name="AFUA_6G04270"
FT                   /product="MFS sugar transporter, putative "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="EBA27236.1"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG325044"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0000F51CEF"
FT                   /db_xref="UniProtKB/TrEMBL:A4DA18"
FT                   /transl_table=1
FT                   /translation="MAVKDVEVPLDDHKEVAEEMDDIQNDLKSEAFNEAAMDAELQQLE
FT                   AQLGSVKQSRLELTFANPAYFTYVLVAFASMGGLLSGLDQSLISGANLTMPKALHLSAS
FT                   QASLVNAGMPLGAVGGALILGPCNEFLGRRMAIIVSCILYTIGAGLEAGAINFGMMFGG
FT                   RFVLGMGVGLEGGTVPVYVAESVPGKIRGNLVSLYQLNIAFGEVLGYAVAAMFFGVAGD
FT                   WRYILGSSLVFSTILLVGMLFMPESPRYLMHKGRPVEAYGVWKRIRGFDSYESKEEFLG
FT                   MRQAVAAENEEQANTKKWAWLDFFTNGRARRAMIYANIMVFLGQFTGVNAVMYYMGVLM
FT                   TKIGFDDRTSVYMSLVGGGSLLIGTIPAVLYMERFGRRYWANVMLPGFFIGLVLVGAGY
FT                   TIDYKTYPATAEGLYLTGIILYMGFFGSYACLTWVIPAEVFPTYLRSYGMTTADANLFL
FT                   CSFIVTYNFTAMMNSMTRIGLTLGFYGGIAVLGWFYQVLFMPETKNKSLEEIDELFSKP
FT                   TSVIVKQNIKSTVEIMRDLSHLRFRKVFSPSPRL"
     MAVKDVEVPL DDHKEVAEEM DDIQNDLKSE AFNEAAMDAE LQQLEAQLGS VKQSRLELTF        60
     ANPAYFTYVL VAFASMGGLL SGLDQSLISG ANLTMPKALH LSASQASLVN AGMPLGAVGG       120
     ALILGPCNEF LGRRMAIIVS CILYTIGAGL EAGAINFGMM FGGRFVLGMG VGLEGGTVPV       180
     YVAESVPGKI RGNLVSLYQL NIAFGEVLGY AVAAMFFGVA GDWRYILGSS LVFSTILLVG       240
     MLFMPESPRY LMHKGRPVEA YGVWKRIRGF DSYESKEEFL GMRQAVAAEN EEQANTKKWA       300
     WLDFFTNGRA RRAMIYANIM VFLGQFTGVN AVMYYMGVLM TKIGFDDRTS VYMSLVGGGS       360
     LLIGTIPAVL YMERFGRRYW ANVMLPGFFI GLVLVGAGYT IDYKTYPATA EGLYLTGIIL       420
     YMGFFGSYAC LTWVIPAEVF PTYLRSYGMT TADANLFLCS FIVTYNFTAM MNSMTRIGLT       480
     LGFYGGIAVL GWFYQVLFMP ETKNKSLEEI DELFSKPTSV IVKQNIKSTV EIMRDLSHLR       540
     FRKVFSPSPR L                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page