(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE31

ASFUM1_6.PE31        Location/Qualifiers
FT   CDS             join(108808..109065,109122..109466)
FT                   /codon_start=1
FT                   /gene_family="HOG000201761" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19902578"
FT                   /orf_name="AFUA_6G00430"
FT                   /product="IgE-binding protein"
FT                   /protein_id="EAL84222.1"
FT                   /db_xref="HOGENOM:HBG051349"
FT                   /db_xref="HOGENOM:HBG325733"
FT                   /db_xref="UniParc:UPI000051E68B"
FT                   /db_xref="UniProtKB/TrEMBL:Q4W8Z7"
FT                   /transl_table=1
FT                   /translation="MKLSTIASVGSLVVGTHSLPAAPASDNGPFQVMALRSASPIHFLG
FT                   MTASRNSFWLGGETATYCPDVVKQQGACPEGTQTVLYTNALDVMVPGGQQIYVDPSGAV
FT                   KFTTAHSASMPPGSTVEGFSYTSGDPLGHWNFSGQGATGFMACPTEGDAPAPYQVFAAI
FT                   SSATVPTGNVADCLGFDAAAIAWTPSQGQTAAAWQYT"
     MKLSTIASVG SLVVGTHSLP AAPASDNGPF QVMALRSASP IHFLGMTASR NSFWLGGETA        60
     TYCPDVVKQQ GACPEGTQTV LYTNALDVMV PGGQQIYVDP SGAVKFTTAH SASMPPGSTV       120
     EGFSYTSGDP LGHWNFSGQG ATGFMACPTE GDAPAPYQVF AAISSATVPT GNVADCLGFD       180
     AAAIAWTPSQ GQTAAAWQYT                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page