(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE310

ASFUM1_6.PE310       Location/Qualifiers
FT   CDS             join(complement(964148..964300),complement(963707..964079),
FT                   complement(963551..963636),complement(962988..963458))
FT                   /codon_start=1
FT                   /gene_family="HOG000201285" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264334"
FT                   /orf_name="AFUA_6G04280"
FT                   /product="Integral membrane protein "
FT                   /protein_id="EAL85612.2"
FT                   /db_xref="HOGENOM:HBG056209"
FT                   /db_xref="UniParc:UPI0000F51CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC6"
FT                   /transl_table=1
FT                   /translation="MNDIPNPHGTGLVVLIWILTGISVVVVSLRVLAKTKIRQFRIDDV
FT                   VMIVVLILGIISGSLHTTAVKYGYGLPDATVPEPVATTGRKFYIIGLASLILCSAVGRA
FT                   AFVLYLLAILGGQKGRRIILTALAILEMVFNSVSVILIFATCTPVSMVWDYAAEGTCTA
FT                   TSIQVNFGYFQSTFNVFVDLYLAVFRPISSGILNSNSESKSRDGRRYRQNRPTPEIYND
FT                   ALGGTVNLLRWGYIEADLVIITASLPCLRSVILSGFHYMTSSGHRSRSYELGAAYTGTH
FT                   AGTASVTAQATSHRKTDSRLRGMLSTRNRADDGASVDRILGSRNSLDGVETGGSSQEGS
FT                   AGIRKQVEVTVVADDRRKGV"
     MNDIPNPHGT GLVVLIWILT GISVVVVSLR VLAKTKIRQF RIDDVVMIVV LILGIISGSL        60
     HTTAVKYGYG LPDATVPEPV ATTGRKFYII GLASLILCSA VGRAAFVLYL LAILGGQKGR       120
     RIILTALAIL EMVFNSVSVI LIFATCTPVS MVWDYAAEGT CTATSIQVNF GYFQSTFNVF       180
     VDLYLAVFRP ISSGILNSNS ESKSRDGRRY RQNRPTPEIY NDALGGTVNL LRWGYIEADL       240
     VIITASLPCL RSVILSGFHY MTSSGHRSRS YELGAAYTGT HAGTASVTAQ ATSHRKTDSR       300
     LRGMLSTRNR ADDGASVDRI LGSRNSLDGV ETGGSSQEGS AGIRKQVEVT VVADDRRKGV       360
//

If you have problems or comments...

PBIL Back to PBIL home page