(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE312

ASFUM1_6.PE312       Location/Qualifiers
FT   CDS             complement(970368..970916)
FT                   /codon_start=1
FT                   /gene_family="HOG000201263" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264336"
FT                   /orf_name="AFUA_6G04300"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85610.1"
FT                   /db_xref="HOGENOM:HBG056207"
FT                   /db_xref="HOGENOM:HBG327829"
FT                   /db_xref="UniParc:UPI000051F664"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC8"
FT                   /transl_table=1
FT                   /translation="MFIKLVTRGDSSNSDDNNSLAPAMIDLLISLLVLIILGIVLVATL
FT                   LVLRRKRQNQMDSELPVHNGQCSPNHRRLTISASSNSRTQSILVYDEKRSLIENSSSPP
FT                   PSPVPEIRITFPEEEDESGKRKSGRVVVVRISDAGAVGLEPCNEELPPYQTSDAERFQS
FT                   LDIERMGGLKEKDDLKRWS"
     MFIKLVTRGD SSNSDDNNSL APAMIDLLIS LLVLIILGIV LVATLLVLRR KRQNQMDSEL        60
     PVHNGQCSPN HRRLTISASS NSRTQSILVY DEKRSLIENS SSPPPSPVPE IRITFPEEED       120
     ESGKRKSGRV VVVRISDAGA VGLEPCNEEL PPYQTSDAER FQSLDIERMG GLKEKDDLKR       180
     WS                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page