(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE313

ASFUM1_6.PE313       Location/Qualifiers
FT   CDS             join(977345..977477,977555..978891,978953..979231,
FT                   979294..979849,979906..980327)
FT                   /codon_start=1
FT                   /gene_family="HOG000201252" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264337"
FT                   /orf_name="AFUA_6G04310"
FT                   /product="mRNA binding protein Pumilio 2, putative "
FT                   /function="RNA binding"
FT                   /protein_id="EAL85609.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG056206"
FT                   /db_xref="HOGENOM:HBG327828"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000051FB52"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDC9"
FT                   /transl_table=1
FT                   /translation="MSGSSMNSDRSRGPHAGMGKGFGAGKSSWNTNIWGDSNLKSGFDD
FT                   QNLAETGFEGKSGSGSLLPSSESDGWSSRPNLPWNTVNTTSASLSRGQNNGMTASPIST
FT                   RPNDRSAPALSDTVDSTSYFSIPRSSGIGSSSGGGNHKTYLNAGADGISPCGDGLSFGN
FT                   FGGLRSGDGRRHPNSSAFGGSPVGTGFPMKQGFTTLDTTRPDEITGSLTMSSLPQALPD
FT                   TMSQPLARNGFAHASHNSASITSQRPTHASHPSFHSESQGFEGRFGGSSMDLSAEINTL
FT                   QLNEGGFSGHPVSRPPYLSHSSYDGSLQRFKYQSAADESSYEAVGGYAGDGLSELPLGH
FT                   HAGRSRLGEGSLSPTDLARMESTFYSALEAGAVPGSHYRNGSATRLSENQALALERKLR
FT                   AMQHDQDLAHGAANSLQRIPYNTPAYDLAGYQAARLNALSGFYPVAQLGGLGSAGIIPR
FT                   GHRDQDPAQVVRSPLLEEFRANSKGNKRYELKDIYNHIVEFSGDQHGSRFIQQKLETAN
FT                   SDEKEQVFREIQPNCLQLMTDVFGNYVVQKLFEHGNQSQKKILANQMKGHVLALSTQMY
FT                   GCRVVQKALEHILTDQQASMVKELENHVLKCVRDQNGNHVIQKAIERVPSQYVQFIINA
FT                   FKGQVSRLAAHPYGCRVIQRMLEHCEEVDRESILAELHACTAHLIPDQFGNYVIQHVIE
FT                   NGEEKDRSRMINVVLSQLLMYSKHKFASNVVEKSIEFGEESQRQQIISTLTSANERGES
FT                   PLLGLMRDQYGNYVIQKVLGQLKGEEREGLIDQIRPLLSQLKKFSYGKQIVAIEKLIFD
FT                   STTLGANSLPPASSTTPPHSHKSSPQPSKRLVNDVENSRAPVVGAAPPTPPPTDNQGHT
FT                   HGPAESKNLAKSTVTSLSVSESASADSNGSVPVSAST"
     MSGSSMNSDR SRGPHAGMGK GFGAGKSSWN TNIWGDSNLK SGFDDQNLAE TGFEGKSGSG        60
     SLLPSSESDG WSSRPNLPWN TVNTTSASLS RGQNNGMTAS PISTRPNDRS APALSDTVDS       120
     TSYFSIPRSS GIGSSSGGGN HKTYLNAGAD GISPCGDGLS FGNFGGLRSG DGRRHPNSSA       180
     FGGSPVGTGF PMKQGFTTLD TTRPDEITGS LTMSSLPQAL PDTMSQPLAR NGFAHASHNS       240
     ASITSQRPTH ASHPSFHSES QGFEGRFGGS SMDLSAEINT LQLNEGGFSG HPVSRPPYLS       300
     HSSYDGSLQR FKYQSAADES SYEAVGGYAG DGLSELPLGH HAGRSRLGEG SLSPTDLARM       360
     ESTFYSALEA GAVPGSHYRN GSATRLSENQ ALALERKLRA MQHDQDLAHG AANSLQRIPY       420
     NTPAYDLAGY QAARLNALSG FYPVAQLGGL GSAGIIPRGH RDQDPAQVVR SPLLEEFRAN       480
     SKGNKRYELK DIYNHIVEFS GDQHGSRFIQ QKLETANSDE KEQVFREIQP NCLQLMTDVF       540
     GNYVVQKLFE HGNQSQKKIL ANQMKGHVLA LSTQMYGCRV VQKALEHILT DQQASMVKEL       600
     ENHVLKCVRD QNGNHVIQKA IERVPSQYVQ FIINAFKGQV SRLAAHPYGC RVIQRMLEHC       660
     EEVDRESILA ELHACTAHLI PDQFGNYVIQ HVIENGEEKD RSRMINVVLS QLLMYSKHKF       720
     ASNVVEKSIE FGEESQRQQI ISTLTSANER GESPLLGLMR DQYGNYVIQK VLGQLKGEER       780
     EGLIDQIRPL LSQLKKFSYG KQIVAIEKLI FDSTTLGANS LPPASSTTPP HSHKSSPQPS       840
     KRLVNDVENS RAPVVGAAPP TPPPTDNQGH THGPAESKNL AKSTVTSLSV SESASADSNG       900
     SVPVSAST                                                                908
//

If you have problems or comments...

PBIL Back to PBIL home page