(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE316

ASFUM1_6.PE316       Location/Qualifiers
FT   CDS             join(complement(987814..987914),complement(986911..987731),
FT                   complement(986636..986823))
FT                   /codon_start=1
FT                   /gene_family="HOG000217813" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264339"
FT                   /orf_name="AFUA_6G04340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85606.1"
FT                   /db_xref="HOGENOM:HBG056204"
FT                   /db_xref="UniParc:UPI000051F8C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD2"
FT                   /transl_table=1
FT                   /translation="MDPDAQIQQQHEPIESKKKSKIQALLSRAQRPEVQGYDERLRTAS
FT                   FVKPAEPKTFEDVAVNEGCKMVRGSLIVGNRYLRCHLLRLSIQVRYKIYEFLFCHHNSN
FT                   VEIGVPYNPKIGDLAILRTSHVFYHEASIALYHSLGDRRLFFRNYGSKSADFLRRQPTP
FT                   LSCCRNRVFQQWLEYPCRNKEIVWRRSFKKIVFLIGASEPLLAVQRRWAFAEFITTLRM
FT                   GEPLRVHELSVVVYNQWKIPGFDEGDLVRALFSGGIEFLGRLIFRGLAGDETERLTQLI
FT                   FALRIPNLTIERVRTRAEEEEVSINSYALKYEINNAEKDIPVSLCSFESKADDKQSLLV
FT                   RCLCCNNTCYLAGVELTNCFMSRSSTPKQ"
     MDPDAQIQQQ HEPIESKKKS KIQALLSRAQ RPEVQGYDER LRTASFVKPA EPKTFEDVAV        60
     NEGCKMVRGS LIVGNRYLRC HLLRLSIQVR YKIYEFLFCH HNSNVEIGVP YNPKIGDLAI       120
     LRTSHVFYHE ASIALYHSLG DRRLFFRNYG SKSADFLRRQ PTPLSCCRNR VFQQWLEYPC       180
     RNKEIVWRRS FKKIVFLIGA SEPLLAVQRR WAFAEFITTL RMGEPLRVHE LSVVVYNQWK       240
     IPGFDEGDLV RALFSGGIEF LGRLIFRGLA GDETERLTQL IFALRIPNLT IERVRTRAEE       300
     EEVSINSYAL KYEINNAEKD IPVSLCSFES KADDKQSLLV RCLCCNNTCY LAGVELTNCF       360
     MSRSSTPKQ                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page