(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE317

ASFUM1_6.PE317       Location/Qualifiers
FT   CDS             join(989682..989843,989892..990070,990118..990229,
FT                   990286..990346,990396..990715)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16264340"
FT                   /orf_name="AFUA_6G04350"
FT                   /product="Putative uncharacterized protein "
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="EAL85605.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG056203"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="UniParc:UPI000051E5B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDD3"
FT                   /transl_table=1
FT                   /translation="MSNLRLCFPPMEGQVNCMHSKLMLLFHPGYLRIVAPTANLTPYDW
FT                   GEMGGVMENSAFLIDLPRKVATTSVGSKTVFEEELVYFLRASTLQENIISRLDEFDFSP
FT                   TSHIMLVHTIGGSHTGNTWRRTGYCGLGRAVNALGLRTSKPINIDFVASSVGSLTDEFL
FT                   RSIYLASKGDGGTTDFTLRTSKTFSARNPNDKDQLIHKNTAEEWKDRFRVYFPSQTTIE
FT                   QSRGGPDCAGTICFQSKWYEGPKFPRHVLRDCKSRRPGLLMHNKVALPPSAEVIS"
     MSNLRLCFPP MEGQVNCMHS KLMLLFHPGY LRIVAPTANL TPYDWGEMGG VMENSAFLID        60
     LPRKVATTSV GSKTVFEEEL VYFLRASTLQ ENIISRLDEF DFSPTSHIML VHTIGGSHTG       120
     NTWRRTGYCG LGRAVNALGL RTSKPINIDF VASSVGSLTD EFLRSIYLAS KGDGGTTDFT       180
     LRTSKTFSAR NPNDKDQLIH KNTAEEWKDR FRVYFPSQTT IEQSRGGPDC AGTICFQSKW       240
     YEGPKFPRHV LRDCKSRRPG LLMHNKVALP PSAEVIS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page