(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE325

ASFUM1_6.PE325       Location/Qualifiers
FT   CDS             join(complement(1013507..1013586),
FT                   complement(1013306..1013411),complement(1012867..1013238),
FT                   complement(1012672..1012800))
FT                   /codon_start=1
FT                   /gene_family="HOG000201071" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19903377"
FT                   /orf_name="AFUA_6G04430"
FT                   /product="ARD/ARD family protein, putative "
FT                   /function="dioxygenase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85597.1"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051213"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020936"
FT                   /db_xref="HOGENOM:HBG660685"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000051FDB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDE1"
FT                   /transl_table=1
FT                   /translation="MSEGGGRADALRNANKQILPLICAITSLLTCCLLSERKTYSVGGP
FT                   AEKKHPTMKAYWYDNKPGDQREPHDSGRPVTVDYLASIGVQYYHFPSLESVNELAKERG
FT                   YKNRDEIVVSPQAMGDVYEEKVKMFFNEHLHEDEEIRYIRDGEGYFDVRGQEDEWVRIK
FT                   LAKDDLIILPAGIYHRFTTDDKNYVKAMRLFQEEPKWTPLNRGPDVDENSHRQSYLRTI
FT                   QNKTVA"
     MSEGGGRADA LRNANKQILP LICAITSLLT CCLLSERKTY SVGGPAEKKH PTMKAYWYDN        60
     KPGDQREPHD SGRPVTVDYL ASIGVQYYHF PSLESVNELA KERGYKNRDE IVVSPQAMGD       120
     VYEEKVKMFF NEHLHEDEEI RYIRDGEGYF DVRGQEDEWV RIKLAKDDLI ILPAGIYHRF       180
     TTDDKNYVKA MRLFQEEPKW TPLNRGPDVD ENSHRQSYLR TIQNKTVA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page