(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE333

ASFUM1_6.PE333       Location/Qualifiers
FT   CDS             join(1046038..1046188,1046301..1046899,1046970..1047197,
FT                   1047268..1047768)
FT                   /codon_start=1
FT                   /gene_family="HOG000201152" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265328"
FT                   /orf_name="AFUA_6G04520"
FT                   /product="SET domain protein"
FT                   /protein_id="EAL85588.1"
FT                   /db_xref="HOGENOM:HBG058928"
FT                   /db_xref="HOGENOM:HBG328304"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000051F8BF"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF0"
FT                   /transl_table=1
FT                   /translation="MSSTTHFPDSDSFQRQSDEFITWLAGKPGVKINSKISIADLRSKS
FT                   AGRGVVARSDIFDGEELFSIPRGLVLSAQNSKLKDLLSQDLEELGPWLSLILVMMYEYL
FT                   LGEQSAWAPYFKILPKSFDTLMFWSPSELRELQGSAIVSKIGKEGAEDSIMQMIAPVVR
FT                   ANPSLFPSVDGLASWDGEAGSHALLRLAHIMGSLIMAYAFDIEKVEDEDDENNDEEDGY
FT                   VTDDEQDQSSKGMVPLADILNADADRNNARLFQEDDSLVMKAIKPIRVGEEIFNDYGEL
FT                   PRADLLRRYGYVTDNYAQYDVVELSLDQICRSAGLQNADIESYPPLAFLEDLELLDDGY
FT                   VIPRPSPEDSLTDFLPDELLVLVKTLTLSSEQLEHQKSKSKAPKPSFGHAEAAILLKAV
FT                   QLVGSQYPTTVAQDEEILSGLVQSEAFQPLNQTDRRQKMAIQVRLGEKYILQTLANMLE
FT                   KFITNSAQSNGGSGLKRGANGDSGDSRRTKAPKN"
     MSSTTHFPDS DSFQRQSDEF ITWLAGKPGV KINSKISIAD LRSKSAGRGV VARSDIFDGE        60
     ELFSIPRGLV LSAQNSKLKD LLSQDLEELG PWLSLILVMM YEYLLGEQSA WAPYFKILPK       120
     SFDTLMFWSP SELRELQGSA IVSKIGKEGA EDSIMQMIAP VVRANPSLFP SVDGLASWDG       180
     EAGSHALLRL AHIMGSLIMA YAFDIEKVED EDDENNDEED GYVTDDEQDQ SSKGMVPLAD       240
     ILNADADRNN ARLFQEDDSL VMKAIKPIRV GEEIFNDYGE LPRADLLRRY GYVTDNYAQY       300
     DVVELSLDQI CRSAGLQNAD IESYPPLAFL EDLELLDDGY VIPRPSPEDS LTDFLPDELL       360
     VLVKTLTLSS EQLEHQKSKS KAPKPSFGHA EAAILLKAVQ LVGSQYPTTV AQDEEILSGL       420
     VQSEAFQPLN QTDRRQKMAI QVRLGEKYIL QTLANMLEKF ITNSAQSNGG SGLKRGANGD       480
     SGDSRRTKAP KN                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page