(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE335

ASFUM1_6.PE335       Location/Qualifiers
FT   CDS             join(1050741..1050849,1050916..1050968,1051022..1051095,
FT                   1051172..1051517)
FT                   /codon_start=1
FT                   /gene_family="HOG000233019" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19056655"
FT                   /orf_name="AFUA_6G04540"
FT                   /product="Calcineurin Ca2+-binding regulatory subunit CnaB "
FT                   /function="calcium ion binding"
FT                   /protein_id="EAL85586.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000051FFE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF2"
FT                   /transl_table=1
FT                   /translation="MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRL
FT                   RKRFMKLDKDSSGTIDRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAF
FT                   SSKGNKEEKLRFAFKVYDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEAD
FT                   KDRDGKISFEEFTEMVENTDVSLSMTLSMF"
     MEQPSEPNNA AMYDARRRRA SVGTSQLLDN IVSASNFDRD EVDRLRKRFM KLDKDSSGTI        60
     DRDEFLSLPQ VSSNPLATRM IAIFDEDGGG DVDFQEFVSG LSAFSSKGNK EEKLRFAFKV       120
     YDIDRDGYIS NGELFIVLKM MVGNNLKDVQ LQQIVDKTIM EADKDRDGKI SFEEFTEMVE       180
     NTDVSLSMTL SMF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page