(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE337

ASFUM1_6.PE337       Location/Qualifiers
FT   CDS             join(complement(1059579..1060434),
FT                   complement(1059426..1059517))
FT                   /codon_start=1
FT                   /gene_family="HOG000019802" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207946"
FT                   /orf_name="AFUA_6G04560"
FT                   /product="37S ribosomal protein S9 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="EAL85584.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059045"
FT                   /db_xref="HOGENOM:HBG328295"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI000051F671"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF4"
FT                   /transl_table=1
FT                   /translation="MAWQRPNCIVQAVQTVRAAQLQSILRTSTVTSGSLLQQRKGTRSY
FT                   ATEAQTTGGNALQVRAASEIDFSQLATRPARVIPASPAYFSGSPKFIDHLLNLERVCAK
FT                   YASLPTVAPNEAPRMAWLKLAQFRDFVGEPVPTKKYKSLVKILQRLNRIEPALVPGEVR
FT                   DTLKTFLRPGNPYGNKPAPATVDEMGRARGKGKRKTSSAVVYLVEGEGEVMVNGKTLVE
FT                   AFPRLHDRESATWPLRCTSRLDKYNVWATVRGGGVTGQAEAITLALARALLVHEPALKP
FT                   ILRKAGVITVDARRVERKKPGHVKARKMPTWVKR"
     MAWQRPNCIV QAVQTVRAAQ LQSILRTSTV TSGSLLQQRK GTRSYATEAQ TTGGNALQVR        60
     AASEIDFSQL ATRPARVIPA SPAYFSGSPK FIDHLLNLER VCAKYASLPT VAPNEAPRMA       120
     WLKLAQFRDF VGEPVPTKKY KSLVKILQRL NRIEPALVPG EVRDTLKTFL RPGNPYGNKP       180
     APATVDEMGR ARGKGKRKTS SAVVYLVEGE GEVMVNGKTL VEAFPRLHDR ESATWPLRCT       240
     SRLDKYNVWA TVRGGGVTGQ AEAITLALAR ALLVHEPALK PILRKAGVIT VDARRVERKK       300
     PGHVKARKMP TWVKR                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page