(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE338

ASFUM1_6.PE338       Location/Qualifiers
FT   CDS             join(1060589..1060825,1060939..1061140,1061387..1062109,
FT                   1062166..1062452)
FT                   /codon_start=1
FT                   /gene_family="HOG000201196" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265330"
FT                   /orf_name="AFUA_6G04570"
FT                   /product="Translation elongation factor eEF-1 subunit
FT                   gamma, putative"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="eukaryotic translation elongation
FT                   factor 1 complex"
FT                   /protein_id="EAL85583.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005853"
FT                   /db_xref="HOGENOM:HBG020891"
FT                   /db_xref="HOGENOM:HBG436026"
FT                   /db_xref="InterPro:IPR001662"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000052045C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF5"
FT                   /transl_table=1
FT                   /translation="MAYHVSYQTLLRSPTPSRDSHKISSIFFHQSPSGISFFFLFEHLL
FT                   LSQPPPPSSFPFSPTSPHPHLTFTMAFGKLYGLPENGRTIAALVAAKCNDLELELVKTE
FT                   ANSAAAFNQSAEYQKLSPLGKIPAFEGANGFTLSESIAIAVYVTSQNEKTTLLGKTKQD
FT                   YAAILRWLSFVNAEVLPKLGAWYRPLLGLDPYNKKNVEDAVKAANKALAVLEKHLTANT
FT                   YLVGERITLADYFGASLLTRAFATVLDKAWRSENVAVTRWYNTIINQAPFKAVVPSPVF
FT                   AEEAIKYTPPKKEEKPKAAPAPAKAAAPAAEPEAQPEKKPKHPLEALGKPEFVLDEWKR
FT                   QYSNEDTRPVALPWFWQNYKPEEYSLYAVDYKYNNELKLTFMANNLIGGFHARLEASRK
FT                   YLFGAQSVYGENYNCVIRGVFLVRGQDWKPAFEVAPDWESYDFRKLDPSNPEDKKLVED
FT                   MWAWDTSVTVDGKEYPHVDGHVFK"
     MAYHVSYQTL LRSPTPSRDS HKISSIFFHQ SPSGISFFFL FEHLLLSQPP PPSSFPFSPT        60
     SPHPHLTFTM AFGKLYGLPE NGRTIAALVA AKCNDLELEL VKTEANSAAA FNQSAEYQKL       120
     SPLGKIPAFE GANGFTLSES IAIAVYVTSQ NEKTTLLGKT KQDYAAILRW LSFVNAEVLP       180
     KLGAWYRPLL GLDPYNKKNV EDAVKAANKA LAVLEKHLTA NTYLVGERIT LADYFGASLL       240
     TRAFATVLDK AWRSENVAVT RWYNTIINQA PFKAVVPSPV FAEEAIKYTP PKKEEKPKAA       300
     PAPAKAAAPA AEPEAQPEKK PKHPLEALGK PEFVLDEWKR QYSNEDTRPV ALPWFWQNYK       360
     PEEYSLYAVD YKYNNELKLT FMANNLIGGF HARLEASRKY LFGAQSVYGE NYNCVIRGVF       420
     LVRGQDWKPA FEVAPDWESY DFRKLDPSNP EDKKLVEDMW AWDTSVTVDG KEYPHVDGHV       480
     FK                                                                      482
//

If you have problems or comments...

PBIL Back to PBIL home page