(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE341

ASFUM1_6.PE341       Location/Qualifiers
FT   CDS             join(complement(1068891..1069099),
FT                   complement(1067587..1068811))
FT                   /codon_start=1
FT                   /gene_family="HOG000201219" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265331"
FT                   /orf_name="AFUA_6G04600"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="EAL85580.1"
FT                   /db_xref="HOGENOM:HBG056189"
FT                   /db_xref="HOGENOM:HBG328270"
FT                   /db_xref="UniParc:UPI000051FDA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDF8"
FT                   /transl_table=1
FT                   /translation="MSTAVAPATAAPLPSPHMNRDPSPKNCPTLAPTTTNSNSSLTPPR
FT                   ASGVSQDGSAVTKGSPRGRKHSSPSSQNGSIPPKVIVKKEPPSSPAMQTQTHTRPRPRK
FT                   LDLSTSLPTAGGLSARAAGGPLTARDGVTMHDVGIACLSPGFQTHDPVMREQLQRSLSV
FT                   RDQQRSIIESRLHKSAKDDGPDGVKPSESNSLGAPKTGASKRRPPPGLSIVPPSAAQFA
FT                   NERVIQSAPLNQSFTGRYQAQPLTRHVVNQSPTLGSTSHIHHVPATQTNNRLPPLSDVF
FT                   GSDALGSRDRDPNRGTYYQAVSGANPSQSNNLPPLPSPRMPGSAVQAQARPREYRSAEE
FT                   AVHELAGGREELLPRIVHYGGHQPPTPPSPHVNNGQAKSRTSTDAAPSAANQPLHPVLQ
FT                   STEGNARRRPRSEYERDNGSPPLGHGPEPHYRPNPALASTANTTYGPFGAGRDSPETQR
FT                   RKKEEFLSLCARAWDLFHS"
     MSTAVAPATA APLPSPHMNR DPSPKNCPTL APTTTNSNSS LTPPRASGVS QDGSAVTKGS        60
     PRGRKHSSPS SQNGSIPPKV IVKKEPPSSP AMQTQTHTRP RPRKLDLSTS LPTAGGLSAR       120
     AAGGPLTARD GVTMHDVGIA CLSPGFQTHD PVMREQLQRS LSVRDQQRSI IESRLHKSAK       180
     DDGPDGVKPS ESNSLGAPKT GASKRRPPPG LSIVPPSAAQ FANERVIQSA PLNQSFTGRY       240
     QAQPLTRHVV NQSPTLGSTS HIHHVPATQT NNRLPPLSDV FGSDALGSRD RDPNRGTYYQ       300
     AVSGANPSQS NNLPPLPSPR MPGSAVQAQA RPREYRSAEE AVHELAGGRE ELLPRIVHYG       360
     GHQPPTPPSP HVNNGQAKSR TSTDAAPSAA NQPLHPVLQS TEGNARRRPR SEYERDNGSP       420
     PLGHGPEPHY RPNPALASTA NTTYGPFGAG RDSPETQRRK KEEFLSLCAR AWDLFHS          477
//

If you have problems or comments...

PBIL Back to PBIL home page