(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE343

ASFUM1_6.PE343       Location/Qualifiers
FT   CDS             join(complement(1075872..1076000),
FT                   complement(1075663..1075782))
FT                   /codon_start=1
FT                   /gene_family="HOG000200993" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265332"
FT                   /orf_name="AFUA_6G04620"
FT                   /product="NADH-ubiquinone oxidoreductase B14 subunit,
FT                   putative"
FT                   /EC_number="1.6.5.3"
FT                   /function="NADH dehydrogenase (ubiquinone) activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="EAL85578.1"
FT                   /db_xref="GO:0008137"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG190789"
FT                   /db_xref="UniParc:UPI000051E828"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG0"
FT                   /transl_table=1
FT                   /translation="MYSLNLPVSAIRTKIRQEFEKHRYVQQLGVVDVLLFQSHAEYQET
FT                   LNYWKQLSHVMKYFRPEEDPGARLPPNFISGFLEGRN"
     MYSLNLPVSA IRTKIRQEFE KHRYVQQLGV VDVLLFQSHA EYQETLNYWK QLSHVMKYFR        60
     PEEDPGARLP PNFISGFLEG RN                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page