(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE344

ASFUM1_6.PE344       Location/Qualifiers
FT   CDS             join(1076782..1077069,1077143..1077292,1077369..1077503)
FT                   /codon_start=1
FT                   /gene_family="HOG000048638" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18207948"
FT                   /gene_name="loc1"
FT                   /orf_name="AFUA_6G04630"
FT                   /product="60S ribosomal subunit assembly/export protein
FT                   loc1"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="EAL85577.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG059879"
FT                   /db_xref="HOGENOM:HBG328239"
FT                   /db_xref="UniParc:UPI00005206C3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q4WDG1"
FT                   /transl_table=1
FT                   /translation="MAPNKPSVKGKSSSKGDSGKSKPLSSASKVSKKHAKRPPPKEVKS
FT                   KARTESSLLKKTKKREYTEEELGLPKLNMITPVGVVKPKGKKKGKVFVDDQEGMMTILA
FT                   MVNAEQEGHIESKLQKARQLEEIREAKRKEAEARHAEKKNKLEEAKQSIRQKRKRKSSG
FT                   NEDSKSDASTSKSSSKSKEKRKSVSFA"
     MAPNKPSVKG KSSSKGDSGK SKPLSSASKV SKKHAKRPPP KEVKSKARTE SSLLKKTKKR        60
     EYTEEELGLP KLNMITPVGV VKPKGKKKGK VFVDDQEGMM TILAMVNAEQ EGHIESKLQK       120
     ARQLEEIREA KRKEAEARHA EKKNKLEEAK QSIRQKRKRK SSGNEDSKSD ASTSKSSSKS       180
     KEKRKSVSFA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page