(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE346

ASFUM1_6.PE346       Location/Qualifiers
FT   CDS             join(1082291..1083253,1083338..1083448,1083603..1083718,
FT                   1083767..1084419,1084472..1085313)
FT                   /codon_start=1
FT                   /gene_family="HOG000200950" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI16265334"
FT                   /orf_name="AFUA_6G04650"
FT                   /product="Putative uncharacterized protein "
FT                   /function="binding"
FT                   /protein_id="EAL85575.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG056188"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019440"
FT                   /db_xref="UniParc:UPI000051ECAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG3"
FT                   /transl_table=1
FT                   /translation="MNYPPSHNGQYPPQYLQQPQQLLYNNADSNVSPYEYGKPVAYPQT
FT                   IISPYSSYGQAYNIEQHQHQPQSHHQQQPPQQQPQQQYVNPSDVFHQPLLPPASSSQLA
FT                   HGSTQYGAQPMVSVAGNSNRSPAVASASTSAQSTPAPSTQSAYQTAPTLNPRNNVFNQY
FT                   SQVALPAPSVPSSNSVATAPSVPSPKPALPLSSKSADSVPSLRPAPPVPSASKPAPPVQ
FT                   AKKPLPQVLVPAPSPEVQQKMQRQGSKKQVQRQNAPQAVQKPTKLPIDYQVLLLSLADE
FT                   YLKAAYGQGTMVALSRREMEIEEYYKLVATGLGCLEAVLKNWRLQPRMEALVRLRYARI
FT                   LFEETENDLEAETALSKGNRMLDLKYSMQHLLARMLHKTNPKASLKAVDGMILDVEAYR
FT                   HSAWEYAFRFLRVSLSLSTSAHQDSVSALQHLHKISNMANRQGDKAVAAISAVIEALAH
FT                   LQQGTSSDAIEQAQRAVAVARSHQLNDELRHIPQLSTLVQMVDICCSLLEYDVNQSSQK
FT                   LKVMQDLMDERLNDPNWRADGSFSIPLSGRSAGPSSIDTGDILQVQNGTLLLSFNWLPQ
FT                   HDLYALCYFLSSITLSAKNSYDGRKAEKFLQEGIRMVKGSFKAPQEIVESMVNANRRVG
FT                   WRRILYCNLLLHQVFLACGRTDWDLANQTLKELRSIAEELGDQLPDTIQRLMEYATGAL
FT                   AQATGDLEAALSIFQSPLLSLSSITSKTARNDPRRDIAILAALNTILILRDPNHPSHSN
FT                   LPSALALVESFCKASPNKYIQAAYYLVCATVQTESTIQTKQYLQQALQSATAISNSQIT
FT                   CMTLTFMSWKYFRGVVGEQAEKSARAGRAMAKKANDRLWVSVTDEMLAETLERQGKSEE
FT                   AEGVRDEGHRVMTGLPPALKRPV"
     MNYPPSHNGQ YPPQYLQQPQ QLLYNNADSN VSPYEYGKPV AYPQTIISPY SSYGQAYNIE        60
     QHQHQPQSHH QQQPPQQQPQ QQYVNPSDVF HQPLLPPASS SQLAHGSTQY GAQPMVSVAG       120
     NSNRSPAVAS ASTSAQSTPA PSTQSAYQTA PTLNPRNNVF NQYSQVALPA PSVPSSNSVA       180
     TAPSVPSPKP ALPLSSKSAD SVPSLRPAPP VPSASKPAPP VQAKKPLPQV LVPAPSPEVQ       240
     QKMQRQGSKK QVQRQNAPQA VQKPTKLPID YQVLLLSLAD EYLKAAYGQG TMVALSRREM       300
     EIEEYYKLVA TGLGCLEAVL KNWRLQPRME ALVRLRYARI LFEETENDLE AETALSKGNR       360
     MLDLKYSMQH LLARMLHKTN PKASLKAVDG MILDVEAYRH SAWEYAFRFL RVSLSLSTSA       420
     HQDSVSALQH LHKISNMANR QGDKAVAAIS AVIEALAHLQ QGTSSDAIEQ AQRAVAVARS       480
     HQLNDELRHI PQLSTLVQMV DICCSLLEYD VNQSSQKLKV MQDLMDERLN DPNWRADGSF       540
     SIPLSGRSAG PSSIDTGDIL QVQNGTLLLS FNWLPQHDLY ALCYFLSSIT LSAKNSYDGR       600
     KAEKFLQEGI RMVKGSFKAP QEIVESMVNA NRRVGWRRIL YCNLLLHQVF LACGRTDWDL       660
     ANQTLKELRS IAEELGDQLP DTIQRLMEYA TGALAQATGD LEAALSIFQS PLLSLSSITS       720
     KTARNDPRRD IAILAALNTI LILRDPNHPS HSNLPSALAL VESFCKASPN KYIQAAYYLV       780
     CATVQTESTI QTKQYLQQAL QSATAISNSQ ITCMTLTFMS WKYFRGVVGE QAEKSARAGR       840
     AMAKKANDRL WVSVTDEMLA ETLERQGKSE EAEGVRDEGH RVMTGLPPAL KRPV             894
//

If you have problems or comments...

PBIL Back to PBIL home page