(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE348

ASFUM1_6.PE348       Location/Qualifiers
FT   CDS             join(1087478..1087666,1087737..1088297)
FT                   /codon_start=1
FT                   /gene_family="HOG000200948" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18207949"
FT                   /orf_name="AFUA_6G04670"
FT                   /product="ER-associated proteolytic system protein Der1,
FT                   putative"
FT                   /protein_id="EAL85573.1"
FT                   /db_xref="HOGENOM:HBG268954"
FT                   /db_xref="HOGENOM:HBG435574"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI000051F66C"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG5"
FT                   /transl_table=1
FT                   /translation="MAAIWGNGGQGGQFPLEQWFYEMPPVTRWWTVATVATSVLVQCHI
FT                   LTPFQLFYSFRAVYFKSQYWRLLTTFLYFGPLNLDLLFHVFFLQRYSRLLEESSGRSPA
FT                   HFSWLLFYAMTSLLLISPFLSLPFLGTALSSSLVYIWSRRNPDTRLSFLGILVFTAPYL
FT                   PWVLMAFSLVVHGIVPKDEICGIVVGHIWYFFNDVYPSLHGGHRPLDPPRWWRRIFDPR
FT                   AAAGEAQRTDTDNVNRDFAAAAAPEVR"
     MAAIWGNGGQ GGQFPLEQWF YEMPPVTRWW TVATVATSVL VQCHILTPFQ LFYSFRAVYF        60
     KSQYWRLLTT FLYFGPLNLD LLFHVFFLQR YSRLLEESSG RSPAHFSWLL FYAMTSLLLI       120
     SPFLSLPFLG TALSSSLVYI WSRRNPDTRL SFLGILVFTA PYLPWVLMAF SLVVHGIVPK       180
     DEICGIVVGH IWYFFNDVYP SLHGGHRPLD PPRWWRRIFD PRAAAGEAQR TDTDNVNRDF       240
     AAAAAPEVR                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page