(data stored in ACNUC7421 zone)

HOGENOMDNA: ASFUM1_6.PE349

ASFUM1_6.PE349       Location/Qualifiers
FT   CDS             join(1092800..1093078,1093140..1093295,1093364..1093999)
FT                   /codon_start=1
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20751320"
FT                   /orf_name="AFUA_6G04680"
FT                   /product="MIPC synthase subunit (SurA), putative "
FT                   /protein_id="EAL85572.1"
FT                   /db_xref="HOGENOM:HBG396429"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI000051EF14"
FT                   /db_xref="UniProtKB/TrEMBL:Q4WDG6"
FT                   /transl_table=1
FT                   /translation="MRRGVLIFLIVNLLIISFLVRSVFTLLSLLVEDASADAIRHAELP
FT                   SPNSSLIEQRPQIIPKIIHQTYKNETIPEVWREAQQSCKDLHPDYEYILWTNEKSREFI
FT                   KNEYPWFLDTFDGYKYPIQRADTIRYFVLAHFGGTYIDLDDGCNRRLDPLLSYPAWVRR
FT                   TVPTGISNDAMGSVPQHPFFLRVIELLKSYDRSWLLPYITVMYSTGPLFLSVIWKEYMQ
FT                   DKPSEAARVRILMQDEYNKYSWSFFTHHVGNSWHGKDARLIFWMGQHWMFLTVLGFILA
FT                   SVVGFCLWWVYGRMILLSSKYRYRYSKLPGLGRLSSPTRRSRGVMPTLLRRVSFKEDEE
FT                   SAHVTETSFELYSRRD"
     MRRGVLIFLI VNLLIISFLV RSVFTLLSLL VEDASADAIR HAELPSPNSS LIEQRPQIIP        60
     KIIHQTYKNE TIPEVWREAQ QSCKDLHPDY EYILWTNEKS REFIKNEYPW FLDTFDGYKY       120
     PIQRADTIRY FVLAHFGGTY IDLDDGCNRR LDPLLSYPAW VRRTVPTGIS NDAMGSVPQH       180
     PFFLRVIELL KSYDRSWLLP YITVMYSTGP LFLSVIWKEY MQDKPSEAAR VRILMQDEYN       240
     KYSWSFFTHH VGNSWHGKDA RLIFWMGQHW MFLTVLGFIL ASVVGFCLWW VYGRMILLSS       300
     KYRYRYSKLP GLGRLSSPTR RSRGVMPTLL RRVSFKEDEE SAHVTETSFE LYSRRD           356
//

If you have problems or comments...

PBIL Back to PBIL home page